DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT5G20260

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_197526.6 Gene:AT5G20260 / 832148 AraportID:AT5G20260 Length:466 Species:Arabidopsis thaliana


Alignment Length:350 Identity:85/350 - (24%)
Similarity:142/350 - (40%) Gaps:87/350 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RFLVYIY--PPEPLNSLGAAPPTSANY-------QKILTAIQESRYYTSDPTAACLFVLGID--- 155
            :|.|::|  ...||..:|   |.:..|       .:|.|.:  |.:..::|..|..|:|.:.   
plant   136 KFKVWVYREGETPLVHMG---PMNNIYSIEGQFMDEIETGM--SPFAANNPEEAHAFLLPVSVAN 195

  Fly   156 ----------TLDRDSLSEDYVRNVPSRLARLPYWNN--GRNHIIFNLY------SGTWPDYAEN 202
                      |..|:.|.:.::..|.....:.||||.  |.:|...:.:      ||:.|:..:|
plant   196 IVHYLYRPLVTYSREQLHKVFLDYVDVVAHKYPYWNRSLGADHFYVSCHDWAPDVSGSNPELMKN 260

  Fly   203 SLGFDAGEAIL--AKASMGVLQLRHGFDVSIPLFHKQFPLRAGATGTVQSNNFPANKKYLLAFKG 265
            .:      .:|  |..|.|.:..|   |||||    :..:..|..|..:.:....:.:.:|||  
plant   261 LI------RVLCNANTSEGFMPQR---DVSIP----EINIPGGHLGPPRLSRSSGHDRPILAF-- 310

  Fly   266 KRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQDNRCDEDN----REY--DRYDYETL 324
              :..|                        .||...|.|..:..|:|.    .||  ...||..|
plant   311 --FAGG------------------------SHGYIRRILLQHWKDKDEEVQVHEYLAKNKDYFKL 349

  Fly   325 LQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLLSNAWVLPFESKIDWKQAAIWADERLLLQVPDI 389
            :..:.|||.|.|..:.|.|.:.|:..||:||::|:.:.|||...:||.:..|....:.:.::..|
plant   350 MATARFCLCPSGYEVASPRVVAAINLGCVPVIISDHYALPFSDVLDWTKFTIHVPSKKIPEIKTI 414

  Fly   390 VRSIPAERIFAL-RQQTQVLWERYF 413
            ::||...|...| |:..||  :|:|
plant   415 LKSISWRRYRVLQRRVLQV--QRHF 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 76/327 (23%)
Glyco_transf_64 477..737 CDD:337333
AT5G20260NP_197526.6 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.