DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT5G19670

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001332525.1 Gene:AT5G19670 / 832087 AraportID:AT5G19670 Length:610 Species:Arabidopsis thaliana


Alignment Length:378 Identity:81/378 - (21%)
Similarity:146/378 - (38%) Gaps:120/378 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 FTRCY---DRFL-VYIYPPEPLNSLGAAPPTSANYQK---ILTAIQESRYYT-SDPTAACLFVLG 153
            |.|.|   :|.| ||:| .|....:...|.....|..   .:..::.::.|| .||..|.|:.:.
plant   270 FKRSYELMERILKVYVY-KEGNRPIFHTPILKGLYASEGWFMKLMEGNKQYTVKDPRKAHLYYMP 333

  Fly   154 ID------TLDRDSLSEDYVRNVPSRL--------------ARLPYWN--NGRNHIIFNLYSGTW 196
            ..      ||        ||||..:|.              ::.|::|  :|.:|.:...:.  |
plant   334 FSARMLEYTL--------YVRNSHNRTNLRQFLKEYTEHISSKYPFFNRTDGADHFLVACHD--W 388

  Fly   197 PDY---------------AENSLGFDAGEAILAKASMGVLQLRHGFDVSIPLFHKQFPLRAGATG 246
            ..|               |:.:.||..|.                 |:|:|    :..:||....
plant   389 APYETRHHMEHCIKALCNADVTAGFKIGR-----------------DISLP----ETYVRAAKNP 432

  Fly   247 TVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQDNRCDE 311
            .......|.:::..|||..       ||        :|.....:|:      :.|::.     |.
plant   433 LRDLGGKPPSQRRTLAFYA-------GS--------MHGYLRQILL------QHWKDK-----DP 471

  Fly   312 DNREYDR--------YDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLLSNAWVLPFESK 368
            |.:.:.|        .:|...:::|.:|:.|:|..:.|.|.:|::...|:||::|:.:|.||...
plant   472 DMKIFGRMPFGVASKMNYIEQMKSSKYCICPKGYEVNSPRVVESIFYECVPVIISDNFVPPFFEV 536

  Fly   369 IDWKQAAIWADERLLLQVPDIVRSIPAERI----FALRQ-QTQVLW----ERY 412
            :||...::...|:.:.::.||:.|||.::.    .|:|: |...||    |:|
plant   537 LDWSAFSVIVAEKDIPRLKDILLSIPEDKYVKMQMAVRKAQRHFLWHAKPEKY 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 68/340 (20%)
Glyco_transf_64 477..737 CDD:337333
AT5G19670NP_001332525.1 Exostosin 281..561 CDD:367297 67/337 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.