DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT5G16890

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_197191.1 Gene:AT5G16890 / 831552 AraportID:AT5G16890 Length:511 Species:Arabidopsis thaliana


Alignment Length:369 Identity:73/369 - (19%)
Similarity:131/369 - (35%) Gaps:107/369 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PTSANYQKILTAIQESR----YYTSDPTAACLFVL---GIDTLDRDSLSEDYVRNVPSRLARLPY 179
            |.|....|.:..:|:.:    :|....|....|:|   ....|.|::|.  :|.:.|:       
plant   174 PESERRLKSVVRVQKQQDADFFYVPFFTTISFFLLEKQQCKALYREALK--WVTDQPA------- 229

  Fly   180 W--NNGRNHIIFNLY-------------SGTW--PDYAENSLGFDAGEAILAKASMGVLQLRHGF 227
            |  :.||:| ||.::             :..|  ||.......:..|:..|.|            
plant   230 WKRSEGRDH-IFPIHHPWSFKSVRKFVKNAIWLLPDMDSTGNWYKPGQVSLEK------------ 281

  Fly   228 DVSIP-----------LFHKQFPLRAGATGTVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLF 281
            |:.:|           ...:..|:|.                .||.|:| |.....|.:.|..|.
plant   282 DLILPYVPNVDICDTKCLSESAPMRT----------------TLLFFRG-RLKRNAGGKIRAKLG 329

  Fly   282 HLHNGRDMVLVTTCRHGKSWRELQDNRCDEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLE 346
            ...:|...::::....|                |..:...:..::.|.|||.|.|....|.|..:
plant   330 AELSGIKDIIISEGTAG----------------EGGKLAAQRGMRRSLFCLCPAGDTPSSARLFD 378

  Fly   347 ALQAGCIPVLLSNAWVLPFESKIDWKQAAIWADERLLLQVPDIVRSIPAERIFALR--QQTQVLW 409
            |:.:|||||::|:....|||..:|:|:.|:.......:|...:|..:.:...|.::  |.....:
plant   379 AIVSGCIPVIVSDELEFPFEGILDYKKVAVLVSSSDAIQPGWLVNHLRSLTPFQVKGLQNNLAQY 443

  Fly   410 ERYFGSIEKIVFTTFEIIRERLPDYPV-RSSLVWNSSPGALLTL 452
            .|:|      ::::        |..|: ...|.|....|.|:.:
plant   444 SRHF------LYSS--------PAQPLGPEDLTWRMIAGKLVNI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 63/305 (21%)
Glyco_transf_64 477..737 CDD:337333
AT5G16890NP_197191.1 Exostosin 117..423 CDD:397245 62/303 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.