DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT5G11130

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_196674.2 Gene:AT5G11130 / 830981 AraportID:AT5G11130 Length:480 Species:Arabidopsis thaliana


Alignment Length:345 Identity:87/345 - (25%)
Similarity:144/345 - (41%) Gaps:89/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RFLVYIY--------PPEPLNSLGAAPPTSANYQKILTAIQ--ESRYYTSDPTAACLFVLGIDTL 157
            ||.::.|        ...|||::.|..      .:.:..|:  .||:..:.|..|.:|.:.:..:
plant   148 RFKIWTYREGEAPLFHKGPLNNIYAIE------GQFMDEIENGNSRFKAASPEEATVFYIPVGIV 206

  Fly   158 D-------------RDSLS---EDYVRNVPSRLARLPYWNNGRNHIIFNLYSGTW-PDYA--ENS 203
            :             ||.|.   :||:..:.:   |.||||..|....|.|....| ||.:  :..
plant   207 NIIRFVYRPYTSYARDRLQNIVKDYISLISN---RYPYWNRSRGADHFFLSCHDWAPDVSAVDPE 268

  Fly   204 LGFDAGEAIL-AKASMGVLQLRHGFDVSIP---LFHKQFPLRAGATGTVQSNNFPANKKYLLAFK 264
            |......|:. |.:|.|...:|   |||:|   :.|.|.       |.|.:...|.|:|.|..|.
plant   269 LYKHFIRALCNANSSEGFTPMR---DVSLPEINIPHSQL-------GFVHTGEPPQNRKLLAFFA 323

  Fly   265 GKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQDNRCDEDNREYDR----YDYETLL 325
            |     |...:.|..||                 :.|:|.     |:|...|:.    .:|..::
plant   324 G-----GSHGDVRKILF-----------------QHWKEK-----DKDVLVYENLPKTMNYTKMM 361

  Fly   326 QNSTFCLVPRGRRLGSFRFLEALQAGCIPVLLSNAWVLPFESKIDWKQAAIWADERLLLQVPDIV 390
            ..:.|||.|.|..:.|.|.:|:|.:||:||::::.:||||...::||..::...   :.::|||.
plant   362 DKAKFCLCPSGWEVASPRIVESLYSGCVPVIIADYYVLPFSDVLNWKTFSVHIP---ISKMPDIK 423

  Fly   391 RSIPA--ERIFALRQQTQVL 408
            :.:.|  |..: |..|.:||
plant   424 KILEAITEEEY-LNMQRRVL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 81/326 (25%)
Glyco_transf_64 477..737 CDD:337333
AT5G11130NP_196674.2 Exostosin 145..429 CDD:367297 81/329 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.