DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT4G32790

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001328745.1 Gene:AT4G32790 / 829415 AraportID:AT4G32790 Length:593 Species:Arabidopsis thaliana


Alignment Length:366 Identity:82/366 - (22%)
Similarity:157/366 - (42%) Gaps:75/366 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 FTRCYD----RFLVYIYPPEPLNSLGAAPPTSANYQK---ILTAIQESR-YYTSDPTAACLFVLG 153
            |.|.|:    :..||:| .|....:...|.....|..   .:..::.|| :.|.||..|.||.|.
plant   256 FKRSYELMEKKLKVYVY-REGKRPVLHKPVLKGIYASEGWFMKQLKSSRTFVTKDPRKAHLFYLP 319

  Fly   154 I------DTL-------DRDSLS--EDYVRNVPSRLARLPYWN--NGRNHIIFNLYSGTWPDYAE 201
            .      :||       |::.:.  ::|:..:.|:.:   :||  .|.:|.:...:     |:|.
plant   320 FSSKMLEETLYVPGSHSDKNLIQFLKNYLDMISSKYS---FWNKTGGSDHFLVACH-----DWAP 376

  Fly   202 NSLGFDAGEAILAKASMGVLQLRHGF----DVSIP---LFHKQFPLRAGATGTVQSNNFPANKKY 259
            :.......:.|.|..:..|.:   ||    ||::|   :...:.||||       ....|.:::.
plant   377 SETRQYMAKCIRALCNSDVSE---GFVFGKDVALPETTILVPRRPLRA-------LGGKPVSQRQ 431

  Fly   260 LLAFKGKRYVHGIGSETRNSLFHLHNGR---DMVLVTTCRHGKSWRELQDNRCDEDNREYDRYDY 321
            :|||    :..|:....|..|.....|.   ||         |.:.|:..::..:...||     
plant   432 ILAF----FAGGMHGYLRPLLLQNWGGNRDPDM---------KIFSEIPKSKGKKSYMEY----- 478

  Fly   322 ETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLLSNAWVLPFESKIDWKQAAIWADERLLLQV 386
               :::|.:|:.|:|..:.|.|.:|||...|:||::|:.:|.||...::|:..|::..|:.:..:
plant   479 ---MKSSKYCICPKGHEVNSPRVVEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPDL 540

  Fly   387 PDIVRSIPAERIFALRQQTQVLWERYFGSIEKIVFTTFEII 427
            .:|:.||..||...::.:.:::.:.:....:...|..|.:|
plant   541 KNILVSITEERYREMQMRVKMVQKHFLWHSKPERFDIFHMI 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 72/325 (22%)
Glyco_transf_64 477..737 CDD:337333
AT4G32790NP_001328745.1 Exostosin 263..547 CDD:397245 72/323 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.