DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT4G13990

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001319928.1 Gene:AT4G13990 / 827035 AraportID:AT4G13990 Length:521 Species:Arabidopsis thaliana


Alignment Length:396 Identity:89/396 - (22%)
Similarity:140/396 - (35%) Gaps:115/396 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 METCFDFTRCYDRFLV-YIYPPEPLNSLGAAPPTSANYQKILTAIQES----------------- 137
            ::.||..||..::.:. ||      .:.|.. |...||:.:|  :::|                 
plant   114 LDNCFKITRGTEKDICPYI------ENYGFG-PVIKNYENVL--LKQSWFTTNQFMLEVIFHNKM 169

  Fly   138 ---RYYTSDPT-AACLFV------------LGIDTLDRDSLSEDYVRNVPSRLARLPYWN--NGR 184
               |..|:|.: |:.:||            .|.:...|||.|.:.:    ..|.....|.  :||
plant   170 INYRCLTNDSSLASAVFVPFYAGLDMSRYLWGFNITVRDSSSHELM----DWLVVQKEWGRMSGR 230

  Fly   185 NHIIFNLYSG--TWPDYAENSLGFDAGEAIL---AKASMGVLQLRHGF---DVSIP---LFHKQF 238
            :|.   |.||  .|....:.....|.|..:.   ...:|.:|.:....   |.:||   .||.: 
plant   231 DHF---LVSGRIAWDFRRQTDNESDWGSKLRFLPESRNMSMLSIESSSWKNDYAIPYPTCFHPR- 291

  Fly   239 PLRAGATGTVQSNNFPANKK--YLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSW 301
                .....|:......::|  ||..|.|     ....|.::|:    .|:   ::..|...|..
plant   292 ----SVDEIVEWQELMRSRKREYLFTFAG-----APRPEYKDSV----RGK---IIDECLESKKQ 340

  Fly   302 RELQDNRCDEDNREYDR-YDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLL-------S 358
            ..|.|  |:..|...|. .:...:.:||.|||.|.|.........:::.||||||..       .
plant   341 CYLLD--CNYGNVNCDNPVNVMKVFRNSVFCLQPPGDSYTRRSMFDSILAGCIPVFFHPGTAYAQ 403

  Fly   359 NAWVLP--------FESKIDWKQAAIWADERLLLQVPDIVRSIPAERIFALRQQTQVLWERYFGS 415
            ..|.||        :....|.|:..|...|||:        .||.||:..||::...|       
plant   404 YKWHLPKNHSSYSVYLPVKDVKEWNIKIKERLI--------EIPEERVVRLREEVIRL------- 453

  Fly   416 IEKIVF 421
            |.|:|:
plant   454 IPKVVY 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 75/355 (21%)
Glyco_transf_64 477..737 CDD:337333
AT4G13990NP_001319928.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.