DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and EPC1

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_191142.1 Gene:EPC1 / 824749 AraportID:AT3G55830 Length:334 Species:Arabidopsis thaliana


Alignment Length:347 Identity:99/347 - (28%)
Similarity:156/347 - (44%) Gaps:49/347 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 ALRQQTQVLWERYFGSIEKIVFTTFEIIRERLPDYPVRSSLVW-NSSPGALLTLPTFADSSRYMP 463
            |.|:..|.|  |.|.:.....|..|..|...|.....|||..| |||   :......:.|.:...
plant    16 AYRRGDQKL--RKFVTARSTKFLLFCCIAFVLVTIVCRSSRPWVNSS---IAVADRISGSRKGYT 75

  Fly   464 FLLNSMGAEPRHNYTAVIYVQIGAALGPNAALYKLVRTITKSQFVERILVLWAADRPLPLKKRWP 528
            .|:|:.   .|::                 .|.|.|........::.|.::|:...        |
plant    76 LLMNTW---KRYD-----------------LLKKSVSHYASCSRLDSIHIVWSEPN--------P 112

  Fly   529 PTSHIP--LHVISLGGSTRSQGAGPTSQTTEGRPSISQRFLPYDEIQTDAVLSLDEDAILNTDEL 591
            |:..:.  ||.: |...||...............|::.||....:::||||.|:|:|.|.....:
plant   113 PSESLKEYLHNV-LKKKTRDGHEVELRFDINKEDSLNNRFKEIKDLKTDAVFSIDDDIIFPCHTV 176

  Fly   592 DFAYTVWRDFPERIVGYPARAHFW----DDSKNAWGYTSKWTNY----YSIVLTGAAFYHRYYNY 648
            |||:.||...|:.:||:..|.| |    :|..|.:.|:..|:.:    ||:||:.|||:|:.|..
plant   177 DFAFNVWESAPDTMVGFVPRVH-WPEKSNDKANYYTYSGWWSVWWSGTYSMVLSKAAFFHKKYLS 240

  Fly   649 LYTNWLSLLLLKTVQQSSNCEDILMNLLVSHVTRKPPIKVTQRKGYKDRETGRSPWNDPDHFIQR 713
            ||||.:...:.:...::.|||||.|:.|:::.|..|.|.| :.|.|:...||.|  :...|..:|
plant   241 LYTNSMPASIREFTTKNRNCEDIAMSFLIANATNAPAIWV-KGKIYEIGSTGIS--SIGGHTEKR 302

  Fly   714 QSCLNTFAAVFGYMPLIRSNLR 735
            ..|:|.|.|.||.|||:.::::
plant   303 THCVNRFVAEFGKMPLVYTSMK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188
Glyco_transf_64 477..737 CDD:337333 78/269 (29%)
EPC1NP_191142.1 Glyco_transf_64 74..322 CDD:286358 81/280 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 135 1.000 Domainoid score I1610
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3064
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.