DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT3G42180

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_189804.4 Gene:AT3G42180 / 823191 AraportID:AT3G42180 Length:470 Species:Arabidopsis thaliana


Alignment Length:261 Identity:72/261 - (27%)
Similarity:112/261 - (42%) Gaps:65/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DYVRNVPSRLARLPYWN--NGRNHIIFNLYSGTW--------PDYAENSLGFDAGEAILAKASMG 219
            |||..|..   :.|:||  ||.:|.:.:.:.  |        |::.:|   |..| ...|..|.|
plant   222 DYVDVVAH---KHPFWNQSNGADHFMVSCHD--WAPDVPDSKPEFFKN---FMRG-LCNANTSEG 277

  Fly   220 VLQLRHGFDVSIPLFHKQFPLRAGATGTVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFHLH 284
               .|...|.|||..:  .|.|......:..|  |.|:..|..|.|:  .||.   .|..||...
plant   278 ---FRRNIDFSIPEIN--IPKRKLKPPFMGQN--PENRTILAFFAGR--AHGY---IREVLFSHW 330

  Fly   285 NGRDMVLVTTCRHGKSWRELQDNRCDEDNREYDR----YDYETLLQNSTFCLVPRGRRLGSFRFL 345
            .|:                      |:|.:.||.    .:|..|:.:|.|||.|.|..:.|.|.:
plant   331 KGK----------------------DKDVQVYDHLTKGQNYHELIGHSKFCLCPSGYEVASPREV 373

  Fly   346 EALQAGCIPVLLSNAWVLPFESKIDWKQAAIWADERLLLQVPD---IVRSIPAERIFALRQQTQV 407
            ||:.:||:||::|:.:.|||...:||.:.::   |..:.::||   |::.||.::.  ||....|
plant   374 EAIYSGCVPVVISDNYSLPFNDVLDWSKFSV---EIPVDKIPDIKKILQEIPHDKY--LRMYRNV 433

  Fly   408 L 408
            :
plant   434 M 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 67/244 (27%)
Glyco_transf_64 477..737 CDD:337333
AT3G42180NP_189804.4 Exostosin 130..421 CDD:281069 67/244 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.