DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and EDA5

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_187015.1 Gene:EDA5 / 821197 AraportID:AT3G03650 Length:499 Species:Arabidopsis thaliana


Alignment Length:288 Identity:61/288 - (21%)
Similarity:102/288 - (35%) Gaps:105/288 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YVRNVPSRLARLPYWNNGRNHIIFNLYSGTWPDYAENSLGFDAGEAILAKASMGVLQLRHGFDVS 230
            :|.||...:. .||     .|::        |.|..::.||| |..||.                
plant   286 HVANVDKDIV-APY-----KHLV--------PSYVNDTSGFD-GRPILL---------------- 319

  Fly   231 IPLFHKQFPLRAGATGTVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTC 295
              .|......:||        .|...:.|.| .|.::.||......||                 
plant   320 --YFQGAIYRKAG--------GFVRQELYNL-LKEEKDVHFSFGSVRN----------------- 356

  Fly   296 RHGKSWRELQDNRCDEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLLSNA 360
             ||.|       :..|.            :::|.|||...|....|.|..:|:.:.||||::|:.
plant   357 -HGIS-------KAGEG------------MRSSKFCLNIAGDTPSSNRLFDAIASHCIPVIISDD 401

  Fly   361 WVLPFESKIDWKQAAIWADERLLLQ---VPDIVRSIPAERIFALRQQTQVLW------ERYFGSI 416
            ..||:|..:::.:..::......|:   :..:||||.       |::...:|      ||||   
plant   402 IELPYEDVLNYNEFCLFVRSSDALKKGFLMGLVRSIG-------REEYNKMWLRLKEVERYF--- 456

  Fly   417 EKIVFTTFEIIRERLPDYPVRSSLVWNS 444
             .:.|.    :::...||.|:  ::|.:
plant   457 -DLRFP----VKDDEGDYAVQ--MIWKA 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 48/229 (21%)
Glyco_transf_64 477..737 CDD:337333
EDA5NP_187015.1 Exostosin 117..430 CDD:397245 46/222 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.