DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and GT13

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_180833.1 Gene:GT13 / 817834 AraportID:AT2G32740 Length:468 Species:Arabidopsis thaliana


Alignment Length:340 Identity:73/340 - (21%)
Similarity:124/340 - (36%) Gaps:76/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 QESRYY---TSDPTAACL----FVLGIDTLD--------RDSLSEDYVRNVPSRLARLPYWNN-- 182
            ::.|:|   |:|.:.:.:    |..|.|...        ||.|.||..:.:..|    |.|..  
plant   143 EKMRHYECLTNDSSLSSVVFVPFYAGFDVRRFWGYNVKLRDELGEDLAQWLRER----PEWRKMY 203

  Fly   183 GRNHII--------FNLYSGTWPDYAENSLGFDAGEAILAKASMGVLQLRHGFDVSIP-LFHKQF 238
            ||:|..        |...:....|:....:.....|.| ...|:......:.|.|..| .||   
plant   204 GRDHFFVTGRVGRDFRRVTDQDSDWGNKLMRLPEFENI-TMLSIETNSRSNEFAVPYPTYFH--- 264

  Fly   239 PLRAGATGTVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSWRE 303
            |.........|.......::||.:|.|         ..|..:.....|.   ::..|...:...:
plant   265 PKSRTEVKRWQRQVTMMQRRYLFSFVG---------ANRPKMEESIRGE---IIRQCLASQGRCK 317

  Fly   304 LQDNRCDEDNRE-YDRYDYETLLQNSTFCLVPRG---RRLGSFRFLEALQAGCIPVLLS------ 358
            ..|  ||..::: .|......:.|:|.|||.|.|   .|..:|   :::.||||||..|      
plant   318 FLD--CDTSSKDCSDPVKVVEVFQDSVFCLQPPGDTPTRRSTF---DSILAGCIPVFFSVDSVYN 377

  Fly   359 -NAWVLPFESKIDWKQAAIWADERL---LLQVPDIVRSIPAERIFALRQQTQVLWERYFGSIEKI 419
             ..|..|   |...|.:...|:|.:   .:.:..::.::..|:|..:|.:.:.:       |.||
plant   378 QYKWYFP---KDRTKYSVYIAEEGVKKGKVSIEKLLANVSEEKISRMRNEVEKI-------IPKI 432

  Fly   420 VFT-TFEIIRERLPD 433
            ::| ..|:..|::.|
plant   433 IYTKPGEVGPEKIED 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 63/297 (21%)
Glyco_transf_64 477..737 CDD:337333
GT13NP_180833.1 TrbM <4..>92 CDD:304513
Exostosin 66..403 CDD:281069 63/287 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.