DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT2G31990

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001324319.1 Gene:AT2G31990 / 817758 AraportID:AT2G31990 Length:525 Species:Arabidopsis thaliana


Alignment Length:401 Identity:88/401 - (21%)
Similarity:148/401 - (36%) Gaps:121/401 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 METCFDFTRCYDRFLVYIYPPEPLNSLGAAP---PTSANYQKILTAIQESRYYTSDPTAACLF-- 150
            ::.|...||..|:..:..|    |::.|..|   ..|::|       ..|.|.|:......:|  
plant   137 IKDCKSITRPKDKISMCKY----LDNSGFGPLIGGKSSDY-------SPSWYATNQFMLEVIFHE 190

  Fly   151 -VLGIDTLDRDS--LSEDYV--------------RNVPSR----------LARLPYWN--NGRNH 186
             :...:.|.|:|  .|..||              |||.:|          |.:.|.|.  :|:||
plant   191 KMKSYECLTRNSSLASAIYVPYYAGLDFRRHLRRRNVAARDAAGKELVKWLKKQPQWKDMSGKNH 255

  Fly   187 II--------FNLYSGTWPDYAENSLGFDAGEAILAKA-SMGVLQLRHGF----DVSIPLFHKQF 238
            .:        |...||:...:..|.:       :|::: ::..|.:....    :.:||     :
plant   256 FLVTGRISRDFRRNSGSRSAWGTNFM-------LLSESLNLTFLSIERSLTSHNEFAIP-----Y 308

  Fly   239 PLRAGATGTVQSNNFP-----ANKKYLLAFKGKRYVHGIGSETRNSLFHLHNG--RDMVLVTTCR 296
            |.....|.|.:...:.     .|:..|.:|.|.:      ..:||     .||  |..|:.....
plant   309 PTYFHPTSTPEILQWQEKIRLTNRTVLFSFAGAQ------RPSRN-----QNGVVRTEVIKQCKS 362

  Fly   297 HGKSWR----ELQDNRCDEDNREYDRYDYETLLQNSTFCLVPRGRRLGSFRFLEALQAGCIPVLL 357
            ..|:.|    ::..|.||      |......|.::|||||.|.|..|......:::.||||||..
plant   363 SSKTCRFLDCDVNANSCD------DPISLMKLFESSTFCLQPPGDSLTRKSVFDSILAGCIPVFF 421

  Fly   358 SNA-------WVLPFESKIDWKQAAIWADERLLL-----QVPDIVRSIPAERIFALRQQTQVLWE 410
            :..       |.:|..|    .:.:::...:.|.     ::.:|:|.||.||:..:|       |
plant   422 NQGSAYKQYLWHIPKNS----SKYSVYITVKELRTGGKNKIEEILRGIPNERVVGMR-------E 475

  Fly   411 RYFGSIEKIVF 421
            .....|.|||:
plant   476 NVIRLIPKIVY 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 75/360 (21%)
Glyco_transf_64 477..737 CDD:337333
AT2G31990NP_001324319.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.