DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and AT2G29040

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_180468.2 Gene:AT2G29040 / 817452 AraportID:AT2G29040 Length:730 Species:Arabidopsis thaliana


Alignment Length:506 Identity:105/506 - (20%)
Similarity:185/506 - (36%) Gaps:174/506 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LRPRRAQ-HESAKDGGVQPHEQLPSFLGAHDMQELQLLQSNQSKSLDSSKHLVTRKPDCRMETCF 95
            ||||..: ::..|...|..|| :|:...    :||                         ::.|:
plant   288 LRPRETRSNDPCKGKYVYMHE-VPALFN----EEL-------------------------LKNCW 322

  Fly    96 DFTRCYDRFLVYIYPPEPLNSLGAAP--PTS-------ANYQKILTAIQESRY-----YTSDPT- 145
            ..:|..|..       |..::.|..|  |..       |..|..|..|..:|.     .|.|.: 
plant   323 TLSRWTDMC-------ELTSNFGLGPRLPNMEGVSGWYATNQFTLEVIFHNRMKQYKCLTKDSSL 380

  Fly   146 AACLFV---LGIDTLD---------RDSLSEDYVRNVPSRLARLPYWN--NGRNHIIFNLYSG-- 194
            |:.::|   .|:|.:.         ||:.:.|.::    .|.....|.  :||:|.   :.:|  
plant   381 ASAVYVPYYPGLDLMRFLWGPFPFMRDAAALDLMK----WLRESQEWKRMDGRDHF---MVAGRT 438

  Fly   195 TWPDY---AENSLGFDAGEAILAKA-SMGVLQLR------HGFDVSIP-LFHK-------QFPLR 241
            || |:   .||...:.....||.:. :|.:|.:.      |||.|..| .||.       |:.:|
plant   439 TW-DFMRTPENESDWGNRLMILPEVRNMTMLLIESSPWNYHGFAVPYPTYFHPSTYAEIIQWQMR 502

  Fly   242 AGATGTVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQD 306
            ...          .|::||.:|.|....: :|...|..           ::..|:..|  |:.:.
plant   503 MRR----------INRRYLFSFVGAPRPN-LGDSIRTE-----------IMDQCKASK--RKCKL 543

  Fly   307 NRCDEDNREYDRYDYETLLQ---NSTFCLVPRGRRLGSFRFLEALQAGCIPVLL-------SNAW 361
            ..|...:::.  |..:.:::   :|||||.|.|.........:::.||||||..       ...|
plant   544 LECISGSQKC--YKPDQIMKFFLSSTFCLQPPGDSYTRRSTFDSILAGCIPVFFHPGSAYAQYIW 606

  Fly   362 VLPFESKIDWKQAAIWADERLL----LQVPDIVRSIPAERIFALRQQTQVLWER--YF------- 413
            .||    .|..:.:::..|:.:    :.:.:::..||..::||:|:|...|..|  ||       
plant   607 HLP----KDIAKYSVFIPEKNVKEGKVSIENVLSRIPRTKVFAMREQVIRLIPRLMYFHPSSKSE 667

  Fly   414 --------------GSIEKIVFTTFEIIRERLP-------DYPVRSSLVWN 443
                          |.:|::     |.:|:|:.       |:|.:.|..:|
plant   668 DTGRFEDAFDVAVEGVLERV-----EGLRKRIEEGKEEIFDFPEQYSWKYN 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 73/353 (21%)
Glyco_transf_64 477..737 CDD:337333
AT2G29040NP_180468.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.