DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and si:dkey-13e3.1

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001106812.1 Gene:si:dkey-13e3.1 / 571594 ZFINID:ZDB-GENE-060503-805 Length:222 Species:Danio rerio


Alignment Length:213 Identity:43/213 - (20%)
Similarity:77/213 - (36%) Gaps:57/213 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DSSKHLVTRKPDCRMETCFDFTRCYDRFLVYIYPPEPLN-----SLGAAPPTSANYQKI------ 130
            ||:|.  .:||...:|         |:.|.||...|.|.     ..||...|.|::..:      
Zfish    22 DSAKS--CKKPHNPLE---------DKLLRYIRDTERLADEVIVKEGAICLTRADFLTLGVRREM 75

  Fly   131 ---------LTAIQESRYYTSDPTAACLFVLGIDTLDRDSLSEDYVRNVPSRLAR--LPYW---- 180
                     :...:|:|.:.::...|.|:|:......:|.::  |..|....:..  ||.|    
Zfish    76 ECEIGNACMILIYEEARAHGNNIYIADLYVVATWKSSKDPVA--YFPNNADLMDALVLPAWIQAT 138

  Fly   181 -NNGRNHIIFNLYSGTWPDYAENSLGF--------DAGEAILAKASMGVLQLRHGFD------VS 230
             ::...:|..:|....|.:....::|.        |.|..:|..|...||.:...|.      :.
Zfish   139 VSDHYVNIAQSLNPAQWTEVTGLNIGVLPQQNNSNDCGIFMLMYALYTVLDIPFNFSQVVFYILL 203

  Fly   231 IPLFHKQ---FPLRAGAT 245
            :.:|:|.   :||.:..|
Zfish   204 LYIFNKVLYCWPLNSNNT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 37/188 (20%)
Glyco_transf_64 477..737 CDD:337333
si:dkey-13e3.1NP_001106812.1 DUF819 <137..216 CDD:242981 13/78 (17%)
Peptidase_C48 <166..196 CDD:304959 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.