DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and extl2

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001070029.1 Gene:extl2 / 558373 ZFINID:ZDB-GENE-060929-1122 Length:332 Species:Danio rerio


Alignment Length:317 Identity:80/317 - (25%)
Similarity:140/317 - (44%) Gaps:66/317 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 NSSPGALLTLPTFADSSRYMPFLLNSMGAEPRHNYTAVIYVQIGAALGPNAALYKLVRTITKSQF 507
            |.....|..|...:::||.:        |:|..::|.::     ........|.:|:........
Zfish    40 NEDINILRELRRSSNTSRTL--------ADPEESFTIIM-----QTYNRTDVLLRLLNHYQAVPH 91

  Fly   508 VERILVLWAADRPLPLKKRWPPTSHIPLHVISLGGSTRSQGAGPTSQTTEGRPSISQRFLPYDEI 572
            ::.|:::|......|.::.|......|:.|:     .|.|...          .:..|.:.:.::
Zfish    92 LQCIIIVWNNPGETPPRRLWDELGPHPVPVL-----FREQRVN----------RMRNRLMMHPDV 141

  Fly   573 QTDAVLSLDEDAILNTDELDFAYTVWRDFPERIVGYPARAHFWDDSKNAWGYTS--------KWT 629
            :|||||.||:|.:|:..::.||::||:.||::|||:..|.|. ..:...:.|.|        ...
Zfish   142 KTDAVLMLDDDILLSVPDISFAFSVWKQFPDQIVGFVPRKHV-SSASGVYSYGSFELQDPDKGGG 205

  Fly   630 NYYSIVLTGAAFYHRYYNYLYTNWLSLLLLKTVQQ-----------SSNCEDILMNLLVSHVTRK 683
            :.||::|.||:|:||.:            ||..|:           :.||:||.||.:|:....|
Zfish   206 DRYSMILVGASFFHRRF------------LKQFQEQPAEVHTLLDRTQNCDDIAMNFIVARQLSK 258

  Fly   684 PPIKVTQRKGY-----KDRETG-RSPWNDPDHFIQRQSCLNTFAAVFGYMPLIRSNL 734
            .|..|..:..:     ||..:| ...|:.|:|.:||..|||..|.::|:|||..||:
Zfish   259 RPSGVFVKPVHMSNLEKDASSGFVGMWHRPEHMLQRSYCLNKLAQIYGHMPLRYSNI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188
Glyco_transf_64 477..737 CDD:337333 73/283 (26%)
extl2NP_001070029.1 Glyco_transf_64 66..314 CDD:286358 71/280 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.