DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and extl2

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:XP_012816366.1 Gene:extl2 / 493327 XenbaseID:XB-GENE-1001404 Length:325 Species:Xenopus tropicalis


Alignment Length:298 Identity:84/298 - (28%)
Similarity:144/298 - (48%) Gaps:40/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 LLNSMGA----EPRHNYTAVIYVQIG---AALGPNAALYKLVRTITKSQFVERILVLWAADRPLP 522
            ||..:||    .|..|..||:.|:.|   :|:.|......:::|..::..:.::|..:.|     
 Frog    23 LLLFLGALTALLPATNEDAVVGVRRGIPLSAVSPKDVFTLIMQTYNRTDLLLKMLNHYQA----- 82

  Fly   523 LKKRWPPTSHIPLHVISLGGST-----RSQGAGPTSQTTEGRP--SISQRFLPYDEIQTDAVLSL 580
                .|..||:.:...::|..|     .|.|..|...|.:.:.  .:..|...:.||||.|||.:
 Frog    83 ----MPGLSHVIVVWNNVGQDTPQELWESFGPHPVPVTFKKQKVNLMRNRLQSFPEIQTQAVLMM 143

  Fly   581 DEDAILNTDELDFAYTVWRDFPERIVGYPARAHFWDDSKNAWGYTS--------KWTNYYSIVLT 637
            |:|.:::..::.||:::|:.||:||||:..|.|....| ..:.|.|        :..:.||::|.
 Frog   144 DDDTLVSAYDISFAFSIWQQFPDRIVGFVPRKHVSSPS-GIYSYGSFELKAPHTETGDMYSMILI 207

  Fly   638 GAAFYHRYYNYLYTNWLSLLLLKTVQQSSNCEDILMNLLVSHVTRKPP---IKVTQRKGYKDRET 699
            ||||:|..|..|:.. |...:...:.|:.||:||.||.:|::...|..   :|.|..:.. ::|.
 Frog   208 GAAFFHSDYLRLFEQ-LPASVHNMIDQTQNCDDIAMNFMVANHLGKASGVLVKPTDMRNL-EKEA 270

  Fly   700 G---RSPWNDPDHFIQRQSCLNTFAAVFGYMPLIRSNL 734
            |   ...|:..:|.:||..|||..|.::..|||..|::
 Frog   271 GSGYTGMWHRAEHLLQRSFCLNKLAEIYSTMPLKYSSI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188
Glyco_transf_64 477..737 CDD:337333 78/282 (28%)
extl2XP_012816366.1 Glyco_transf_64 60..311 CDD:401264 72/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.