DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and EXTL2

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_001248370.1 Gene:EXTL2 / 2135 HGNCID:3516 Length:338 Species:Homo sapiens


Alignment Length:331 Identity:85/331 - (25%)
Similarity:147/331 - (44%) Gaps:61/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 GALLT-LPTFADSSRYMPFL---LNSMGAEPRHNYTAVIYVQIGAALGPNAALYKLVRTITKSQF 507
            |||.. ||:..:....|  |   :.|.|.....::|.::.......|     |.||:........
Human    42 GALTALLPSVKEDKMLM--LRREIKSQGKSTMDSFTLIMQTYNRTDL-----LLKLLNHYQAVPN 99

  Fly   508 VERILVLW------AADRPLPLKKRWPPTSHIPLHVISLGGSTRSQGAGPTSQTTEGRPSISQRF 566
            :.:::|:|      |.|      :.|......|:.||             ..|.|..|  :..|.
Human   100 LHKVIVVWNNIGEKAPD------ELWNSLGPHPIPVI-------------FKQQTANR--MRNRL 143

  Fly   567 LPYDEIQTDAVLSLDEDAILNTDELDFAYTVWRDFPERIVGYPARAHFWDDSKNAWGYTSKWT-- 629
            ..:.|::|:|||.:|:|.:::|.:|.||::||:.||::|||:..|.|. ..|...:.|.|...  
Human   144 QVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHV-STSSGIYSYGSFEMQA 207

  Fly   630 ------NYYSIVLTGAAFYHRYYNYLYTNWLSLLLLKTVQQSSNCEDILMNLLVS-HVTR----- 682
                  :.||:||.||:|::..|..|:.. ....:...:..:.||:||.||.::: |:.:     
Human   208 PGSGNGDQYSMVLIGASFFNSKYLELFQR-QPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIF 271

  Fly   683 -KPPIKVTQRKGYKDRETGRS-PWNDPDHFIQRQSCLNTFAAVFGYMPLIRSNLRMDPMLYRDPV 745
             ||   |......|:..:|.| .|:..:|.:||..|:|....::..|||..||:.:....:  |.
Human   272 VKP---VNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGF--PY 331

  Fly   746 SNLRKK 751
            :|.::|
Human   332 ANYKRK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188
Glyco_transf_64 477..737 CDD:337333 73/281 (26%)
EXTL2NP_001248370.1 Glyco_transf_64 74..321 CDD:286358 71/277 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.