DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttv and LOC108179064

DIOPT Version :9

Sequence 1:NP_001356963.1 Gene:ttv / 36614 FlyBaseID:FBgn0265974 Length:772 Species:Drosophila melanogaster
Sequence 2:XP_021323864.1 Gene:LOC108179064 / 108179064 -ID:- Length:313 Species:Danio rerio


Alignment Length:338 Identity:163/338 - (48%)
Similarity:211/338 - (62%) Gaps:45/338 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAKKRYILV-FVSCAFLAYAYFGGYRLKVSPLRPRRAQHESAKDGGVQP--------HEQLPSF 56
            |||:|:|:|: ..:|.::...|:.|.:.::..|...|.        |..|        ...||:|
Zfish     1 MQARKKYVLLGLCTCCWILLYYWAGLQERLLGLITHRR--------GEVPRPWPDWLDRALLPNF 57

  Fly    57 LGAHDMQELQLLQSN---------QSKSLDSSKHLVTRKPDCRMETCFDFTRCYDR--FLVYIYP 110
            ....|:|       |         |.|...||.:..:|   |||:|||||.||..:  |.|||||
Zfish    58 AEQLDLQ-------NGGGPGDSPRQRKQAWSSIYKDSR---CRMDTCFDFGRCQTQSGFRVYIYP 112

  Fly   111 PEPLNSLGAAPPTSANYQKILTAIQESRYYTSDPTAACLFVLGIDTLDRDSLSEDYVRNVPSRLA 175
            ||      .....|.:|:||||::.|||||||||..||||||||||||||.||:.:|.||..|:.
Zfish   113 PE------KGERVSESYRKILTSVSESRYYTSDPREACLFVLGIDTLDRDQLSQQFVPNVDERIR 171

  Fly   176 RLPYWNNGRNHIIFNLYSGTWPDYAENSLGFDAGEAILAKASMGVLQLRHGFDVSIPLFHKQFPL 240
            ..|.||:||||:||||||||||:|.|: |||:.|:|||||||:.....|.|||:|||||.|:.|.
Zfish   172 GYPLWNDGRNHVIFNLYSGTWPNYTED-LGFNVGQAILAKASLNTEHFRPGFDISIPLFSKEHPQ 235

  Fly   241 RAGATGTVQSNNFPANKKYLLAFKGKRYVHGIGSETRNSLFHLHNGRDMVLVTTCRHGKSWRELQ 305
            :.|..|.:..|:.|..:||||.||||||:.||||:|||:|.|:|||:|:|.:|||||||.|.:.:
Zfish   236 KGGKRGWLVRNSVPPRRKYLLMFKGKRYLTGIGSDTRNALHHIHNGKDIVSLTTCRHGKDWEKHK 300

  Fly   306 DNRCDEDNREYDR 318
            |.|||.||:||:|
Zfish   301 DARCDHDNQEYER 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttvNP_001356963.1 Exostosin 102..393 CDD:335188 129/219 (59%)
Glyco_transf_64 477..737 CDD:337333
LOC108179064XP_021323864.1 Exostosin 103..>311 CDD:308581 126/214 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.