DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr51A and Cpr62Bc

DIOPT Version :9

Sequence 1:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:116 Identity:34/116 - (29%)
Similarity:52/116 - (44%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LCMAAPPRQESEAERIEREEYEKYQNENAQYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF- 77
            |..|||..........|..:|..|    .:|.:|..|.|.......|::|.|:|..|:||||.. 
  Fly    28 LYAAAPAIYAGHGHHDEGIDYHAY----PKYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVE 88

  Fly    78 -DGFVKRRVEYIA-DKDGYRVLKDEIEDVGNGPSFN---PDGIANVEGSMI 123
             ||.| |.|||.| |.:|:..:..:     .||:.:   |..:|:...:::
  Fly    89 PDGSV-RTVEYTADDHNGFNAVVHK-----TGPTVHHAAPAVVAHAAPAVV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:278791 22/52 (42%)
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.