DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oaz and ZNF410

DIOPT Version :9

Sequence 1:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster
Sequence 2:NP_001229853.1 Gene:ZNF410 / 57862 HGNCID:20144 Length:516 Species:Homo sapiens


Alignment Length:505 Identity:110/505 - (21%)
Similarity:172/505 - (34%) Gaps:132/505 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KEEEAEEGSEELQHPRDEVVASDAAANANGHCKSSGHEEDAVDAEEPEDLELDDELLSLSGD-ED 155
            :||:.:.|..:|.             :...|..||        .|.|....|....:::..| |:
Human    62 REEDGKSGCSDLN-------------DTTNHSNSS--------KEVPSSAVLRSLRVNVGPDGEE 105

  Fly   156 YDDEELQSLDSFYSDMYSTHTSSSYSPSISDGTMTPN---------SHHLIGAPTAAGQEDHPTE 211
            ...:.:|....|.|...|:.......||.|...:..|         :.||:..     |::....
Human   106 TRAQTVQKSPEFLSTSESSSLLQDLQPSDSTSFILLNLTRAGLGSSAEHLVFV-----QDEAEDS 165

  Fly   212 GK--INGGADGEDLPKPKRLPHFHHHHHHHYHHQQALKIANKLRKINKEAKM------------- 261
            |.  ::..:....:|...|:....|..          .||....::.|.||.             
Human   166 GNDFLSSESTDSSIPWFLRVQELAHDS----------LIAATRAQLAKNAKTSSNGENVHLGSGD 220

  Fly   262 GATAGGGATGAASKFDKLTGEG--------------IKS-RGDGSYQC--QFCEKTFPRLGYLKH 309
            |.:...|......|..|.|.||              :|: |.|.|:.|  :.|.|:|..|..||.
Human   221 GQSKDSGPLPQVEKKLKCTVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCGKSFYVLQRLKV 285

  Fly   310 HVQSHAEHLPFKCEY--CSKLFKHKRSRDRHKKLHTNERNYKC--PHCEAAFSRSDHLKIHMKTH 370
            |:::|....||.|..  |.|.|....:...|:::||.|:.:.|  ..|..:|:....|:.|:..|
Human   286 HMRTHNGEKPFMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVH 350

  Fly   371 DIQKPFQCSMCNRGYNTAAALTSHMQKHKKNAAILAAGGNPNALNYSPRSTGS--ASASVSSNGS 433
            ..:||.||.:|.:.::.:.:...||:||  :..:.|||.........|....|  ..|||.|.. 
Human   351 SGEKPHQCQVCGKTFSQSGSRNVHMRKH--HLQLGAAGSQEQEQTAEPLMGSSLLEEASVPSKN- 412

  Fly   434 LQKRRYALALASDSSPS----RMDFPKRSRSNHVGG----TTTTATPTPLLRCSYCPKVT----- 485
                    .::.:|.||    .::.|   .:|.:.|    .....:|..|   |..|.||     
Human   413 --------LVSMNSQPSLGGESLNLP---NTNSILGVDDEVLAEGSPRSL---SSVPDVTHHLVT 463

  Fly   486 --------EFSSLEQLNAHLQSVHEQPQTQAVKTPVQEGEG-FQLSCEYC 526
                    |.|.|..:|         ||......|..|..| |...|..|
Human   464 MQSGRQSYEVSVLTAVN---------PQESLAPLPRLECSGAFSAHCNLC 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 8/21 (38%)
C2H2 Zn finger 322..342 CDD:275368 5/21 (24%)
zf-H2C2_2 334..359 CDD:290200 7/26 (27%)
COG5048 336..769 CDD:227381 52/217 (24%)
zf-C2H2 348..370 CDD:278523 5/23 (22%)
C2H2 Zn finger 350..370 CDD:275368 5/21 (24%)
C2H2 Zn finger 378..398 CDD:275368 4/19 (21%)
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
ZNF410NP_001229853.1 zf-C2H2_8 268..351 CDD:292531 24/82 (29%)
C2H2 Zn finger 271..290 CDD:275370 7/18 (39%)
zf-H2C2_2 283..309 CDD:290200 10/25 (40%)
C2H2 Zn finger 298..320 CDD:275368 5/21 (24%)
zf-H2C2_2 312..338 CDD:290200 6/25 (24%)
C2H2 Zn finger 328..350 CDD:275368 5/21 (24%)
zf-H2C2_2 342..367 CDD:290200 8/24 (33%)
C2H2 Zn finger 358..378 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46179
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.