DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Oaz and Sry-beta

DIOPT Version :9

Sequence 1:	NP_001188929.1	Gene:	Oaz / 36609	FlyBaseID:	FBgn0284250	Length:	1366	Species:	Drosophila melanogaster
Sequence 2:	NP_001303451.1	Gene:	Sry-beta / 43570	FlyBaseID:	FBgn0003511	Length:	356	Species:	Drosophila melanogaster

Alignment Length:	137	Identity:	31/137 - (22%)
Similarity:	55/137 - (40%)	Gaps:	31/137 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   294 CQFCEKTFPRLGYLKHHVQS------------------------------HAEHLPFKCEYCSKL 328
            |..|.:.|.....|:.|:::                              |......:|.||.|.
  Fly   173 CHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKK 237

  Fly   329 FKHKRSRDRHKKLHTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQK-PFQCSMCNRGYNTAAALT 392
            |.|||:..||.::|.:::.|:|..|...||.|..:..|:..||.:: ...|.:|::.:.|.....
  Fly   238 FSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRTYK 302

  Fly   393 SHMQKHK 399
            .|::.|:
  Fly   303 HHLRTHQ 309

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Oaz	NP_001188929.1	C2H2 Zn finger	294..314	CDD:275368	5/49 (10%)
		C2H2 Zn finger	322..342	CDD:275368	10/19 (53%)
		zf-H2C2_2	334..359	CDD:290200	7/24 (29%)
		COG5048	336..769	CDD:227381	17/65 (26%)
		zf-C2H2	348..370	CDD:278523	7/21 (33%)
		C2H2 Zn finger	350..370	CDD:275368	6/19 (32%)
		C2H2 Zn finger	378..398	CDD:275368	4/19 (21%)
		C2H2 Zn finger	630..650	CDD:275368
		C2H2 Zn finger	659..679	CDD:275368
		C2H2 Zn finger	689..707	CDD:275368
		C2H2 Zn finger	1020..1041	CDD:275368
		C2H2 Zn finger	1049..1069	CDD:275368
		C2H2 Zn finger	1197..1217	CDD:275368
		C2H2 Zn finger	1229..1246	CDD:275368
		C2H2 Zn finger	1258..1278	CDD:275368
Sry-beta	NP_001303451.1	C2H2 Zn finger	203..223	CDD:275368	0/19 (0%)
		C2H2 Zn finger	231..251	CDD:275368	10/19 (53%)
		C2H2 Zn finger	259..308	CDD:275368	12/48 (25%)
		C2H2 Zn finger	288..303	CDD:275370	3/14 (21%)
		zf-C2H2	315..337	CDD:278523
		C2H2 Zn finger	317..337	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45449831
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930