DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oaz and CG14710

DIOPT Version :9

Sequence 1:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:393 Identity:94/393 - (23%)
Similarity:147/393 - (37%) Gaps:117/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKLGEKEDEENTGLLEPKEELLSGDEDNEDNEGEDEDEEVADEVAPEGGGGERPQLVPNESQQQS 77
            ||||.:..|        |||:.:.:      ||:::.|:.:.||....|      .:.|||    
  Fly   110 LKLGTENQE--------KEEITAIE------EGDEQQEDQSQEVLDFNG------FIINES---- 150

  Fly    78 WPTADEPAAPAAVAKEEEAEEGSEELQHPRDEVVASDAAANANGHCKSSGHEEDAVDAEEPEDLE 142
                        :.::||....|.|      :::.|              |.:..||.::.|:| 
  Fly   151 ------------IEEDEEPNTESPE------QILIS--------------HMDSYVDDQQMEEL- 182

  Fly   143 LDD--ELLSLSGDEDYDDEELQSLDSFYSDMYSTH-----TSSSYSPSISDGTMTPNSHHLIGAP 200
            :||  ||:          |||.:.::||...|...     ::.|..||.......|      |.|
  Fly   183 IDDKGELV----------EELSNANTFYEVEYGDEELLMSSAPSPHPSFKMDKQKP------GRP 231

  Fly   201 TAAGQEDHPTEGKINGGADGEDLPKPKRLPHFHHHHHHHYHHQQALKIANKLRKINKEAKMGATA 265
            .....|.......||....|.. ||.|                             :|.|.....
  Fly   232 RKPDAELKFKRKDINAKERGNQ-PKCK-----------------------------EEEKFMCIL 266

  Fly   266 GGGATGAASKF--DKLTGEGIKSRGDGSYQCQFCEKTFPRLGYLKHHVQSHAEHLPFKCEYCSKL 328
            .|......|.|  ..:|....|     .:||:.|.|:|.::|.|:.|::.|....|:||.||.:.
  Fly   267 CGNVFYKKSVFTAHMMTHSEYK-----PHQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRH 326

  Fly   329 FKHKRSRDRHKKLHTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQKPFQCSMCNRGYNTAAALTS 393
            |..:..|.||:::|||.|.|.|..|...|:.:..||.|:.:|..||.:.|.:|.:.:.....|.:
  Fly   327 FYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKA 391

  Fly   394 HMQ 396
            |:|
  Fly   392 HLQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 7/19 (37%)
C2H2 Zn finger 322..342 CDD:275368 7/19 (37%)
zf-H2C2_2 334..359 CDD:290200 11/24 (46%)
COG5048 336..769 CDD:227381 21/61 (34%)
zf-C2H2 348..370 CDD:278523 7/21 (33%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 5/19 (26%)
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 43/139 (31%)
C2H2 Zn finger 264..284 CDD:275368 3/19 (16%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 7/19 (37%)
zf-H2C2_2 304..327 CDD:290200 8/22 (36%)
C2H2 Zn finger 320..340 CDD:275368 7/19 (37%)
zf-H2C2_2 335..357 CDD:290200 10/21 (48%)
C2H2 Zn finger 348..368 CDD:275368 6/19 (32%)
C2H2 Zn finger 376..395 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.