DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oaz and znf410

DIOPT Version :9

Sequence 1:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster
Sequence 2:XP_009293316.1 Gene:znf410 / 402951 ZFINID:ZDB-GENE-040426-1817 Length:426 Species:Danio rerio


Alignment Length:511 Identity:107/511 - (20%)
Similarity:183/511 - (35%) Gaps:148/511 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRRKQAKP--------RACLKLGEKEDEENTGLLEPKEELLSGDEDNEDNEGEDEDEEVADEVA 57
            :|....:||        .||:.|||..:|..   |:|....|           |..:..::..|:
Zfish     2 LSDELDSKPELLVEFVQNACIPLGESLEEAE---LKPSCVPL-----------ELPESALSHAVS 52

  Fly    58 PEGGGGERPQLVPNESQQQSWPTADEPAAPAAVAKEEEAEEGSEELQHPRDEV------VASDAA 116
            |     ....|.|..|     |...:..:|||.    :.....:|||: .|..      :|...|
Zfish    53 P-----PLSDLCPERS-----PVLVQLQSPAAA----QTPTILQELQN-NDSTSYILLNLAKGLA 102

  Fly   117 ANANGHCKSSGHEEDAVDAEEPEDLELDDELLSLSGDED---YDDEELQSLDSFYSDMYSTHTSS 178
            |:|    :.....:|.||..:.|        :|:|||..   |...:..:.||.        .::
Zfish   103 ASA----EPLVFVQDEVDEAQEE--------VSVSGDISTPWYLRVQELAHDSL--------IAA 147

  Fly   179 SYSPSISDGTMTPNSHHLIGAPTAAGQEDHPTEGKINGGADGEDLPKPKRLPH------FHHHHH 237
            :.:....|...|.||.||:..  |:..:...:..:::..::     |..|.|:      |.:..|
Zfish   148 TRAQLARDARATANSEHLLSC--ASDGQKRESSPRVSSRSE-----KIHRCPYESCCRTFTYPAH 205

  Fly   238 HHYHHQQALKIANKLRKINKEAKMGATAGGGATGAASKFDKLTGEGIKSRGDGSYQC--QFCEKT 300
            ..||    ||                                     ..|.|.:::|  :.|.|:
Zfish   206 LKYH----LK-------------------------------------THRNDRTFRCGAEGCGKS 229

  Fly   301 FPRLGYLKHHVQSHAEHLPFKC--EYCSKLFKHKRSRDRHKKLHTNERNYKCP--HCEAAFSRSD 361
            |..|..|:.|:::|....||.|  ..|.|.|....:...|::.||.|:.:.|.  :|..:|:...
Zfish   230 FYVLQRLQVHMRTHNGEKPFICSENNCGKKFTTAGNLKNHRRTHTGEKPFLCEVNNCGRSFAEYS 294

  Fly   362 HLKIHMKTHDIQKPFQCSMCNRGYNTAAALTSHMQKHKKNAAILAAGGNPNALNYSPRSTGSASA 426
            .|:.||..|..:||..||:|.:.::.:.:...||:|....               ...||.:..:
Zfish   295 SLRKHMLVHSGEKPHVCSVCGKTFSQSGSRNVHMKKRHSG---------------DDSSTDTGYS 344

  Fly   427 SVSSNG------SLQKRRYALALASDSSPSRMDFPKRSRSNHVGGTTTTATPT-PL 475
            ::.:||      :.:....:..|..:...|......|::|....||.:.|.|| ||
Zfish   345 NIDNNGREIATCTSEALTQSSLLEEEGGVSLHHSILRTQSFCQDGTCSPAAPTDPL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 7/21 (33%)
C2H2 Zn finger 322..342 CDD:275368 5/21 (24%)
zf-H2C2_2 334..359 CDD:290200 7/26 (27%)
COG5048 336..769 CDD:227381 34/149 (23%)
zf-C2H2 348..370 CDD:278523 6/23 (26%)
C2H2 Zn finger 350..370 CDD:275368 6/21 (29%)
C2H2 Zn finger 378..398 CDD:275368 5/19 (26%)
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
znf410XP_009293316.1 COG5048 215..>399 CDD:227381 47/198 (24%)
C2H2 Zn finger 224..243 CDD:275368 6/18 (33%)
zf-H2C2_2 236..262 CDD:290200 9/25 (36%)
C2H2 Zn finger 251..273 CDD:275368 5/21 (24%)
zf-H2C2_2 265..291 CDD:290200 6/25 (24%)
C2H2 Zn finger 281..303 CDD:275368 6/21 (29%)
zf-H2C2_2 295..320 CDD:290200 9/24 (38%)
C2H2 Zn finger 311..329 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46179
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.