DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oaz and CG30431

DIOPT Version :9

Sequence 1:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:486 Identity:110/486 - (22%)
Similarity:160/486 - (32%) Gaps:192/486 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EGSEEL-----QHPRDEVVASDAAANANGHCKSSGHEEDAVDAEEPEDLELDDELLSLSGD---- 153
            |.||::     :|.:..|...||.|           .:|.::.       |:.|:.||.|.    
  Fly    75 EHSEQVLRMRHEHWKHTVAVGDALA-----------LDDVLEC-------LEREVGSLEGPMSVP 121

  Fly   154 --------------EDYDDEELQSLDSFYSDMYSTHTSSSY-SPSISDGTMTPNSHHLIGAPTAA 203
                          |..|.|.|...||.:|:    |...|| ..|:..|::....|....|...|
  Fly   122 LQASKPVAHVAPLMETVDFESLDFQDSSHSE----HDIPSYWESSVDSGSLNTPHHQPETAELFA 182

  Fly   204 GQEDHPTEGKINGGADGEDLPKPKRLPHFHHHHHHHYHHQQALKIANKLRKIN---KEAKMGATA 265
            .:...|.|.......|..:.||.:|.                     :.|:.|   ||.|     
  Fly   183 VEPPTPPESSEEPAPDAAEKPKMRRA---------------------RPRQDNVKPKERK----- 221

  Fly   266 GGGATGAASKFDKLTGEGIKSRGDGSYQCQFCEKTFPRLGYLKHHVQSHAEH----LPFKCEYCS 326
               |:||           :..|  ..:.|..|||.|.|...||.|:.  |.|    :.::||.|.
  Fly   222 ---ASGA-----------VHPR--SLHPCPECEKKFTRNFQLKLHMT--AVHGMGEMRYQCEECR 268

  Fly   327 KLFKHKRSRDRH-KKLHTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQ-KP--FQCSMCNRGYNT 387
            |.|..:.|...| |.:|:.||.:.|.||:..|.....|..|::||..: ||  |:|..|::.:.|
  Fly   269 KNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPT 333

  Fly   388 AAALTSHMQKHKKNAAILAAGGNPNALNYSPRSTGSASASVSSNGSLQKRRYALALASDSSPSRM 452
            .:.|.:||:.|           |||                                       |
  Fly   334 KSDLRTHMRSH-----------NPN---------------------------------------M 348

  Fly   453 DFPKRSRSNHVGGTTTTATPTPLLRCSYCPKVTEFSSLEQLNAHLQSVH--EQPQTQAVKTPVQE 515
            :.|                    .:|..|.|.  |.:...||:|| .||  |:|           
  Fly   349 ERP--------------------FKCDRCSKA--FFTRGHLNSHL-LVHTGEKP----------- 379

  Fly   516 GEGFQLSCEYCTMKFGNIAGLFQHMRSTHMD 546
                 .:||||...:.::..|..||...|.|
  Fly   380 -----FACEYCDKCYQSVGNLNNHMVRLHAD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 9/19 (47%)
C2H2 Zn finger 322..342 CDD:275368 8/20 (40%)
zf-H2C2_2 334..359 CDD:290200 10/25 (40%)
COG5048 336..769 CDD:227381 49/217 (23%)
zf-C2H2 348..370 CDD:278523 6/21 (29%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 6/19 (32%)
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 3/6 (50%)
C2H2 Zn finger 234..255 CDD:275368 10/22 (45%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 27/140 (19%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 8/22 (36%)
zf-H2C2_2 366..389 CDD:290200 12/39 (31%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.