DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oaz and CG2120

DIOPT Version :9

Sequence 1:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:256 Identity:69/256 - (26%)
Similarity:96/256 - (37%) Gaps:50/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1041 HNSTGK-HKCLICDEVFPSPAILAEHKLQHSKVGQSGKCSHCGQPLEDVAAFRAHLSEHGSDGAS 1104
            |.:||| |.|.|||..|.....|..||:.|:. .:...|..||:....:...|.|...|   .|.
  Fly    92 HRTTGKDHTCDICDRRFSEAYNLRIHKMTHTD-EKPHVCVECGKGFRQLNKLRIHAVTH---TAE 152

  Fly  1105 LPLACICCRQTLHSEFELSLHAKFHTKSSSSGGSLQEPVCALCLEPLPDATEGPAKLCDKCCRK- 1168
            .|..|..|.:.......|::|.:.||      |....|    ||     ||:         |.. 
  Fly   153 RPHKCDICGKGFRYANYLTVHRRLHT------GEKPYP----CL-----ATD---------CHLS 193

  Fly  1169 -HNLNGKR----GKHSEPATSLPAPPSAFVENR--------CNLCKMILPHAQKLQEHLVEHTFA 1220
             |:::.:|    .:|:......|..|.|..|.|        |.:|..:|.....|..||..|   
  Fly   194 FHSIHARRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKRH--- 255

  Fly  1221 GTEQRGFNC--YICSAVFTAPGGLLNHMGEHGAHSRPYDCNLCPEKFFFRAELEHHQRGHE 1279
             ..||.|.|  ..|...|.:...|.:|...| ...||:.|.|||.:|..::..:.|.:.||
  Fly   256 -YNQRDFPCPQPECGKRFFSASELKHHQIAH-TQQRPFACPLCPARFLRKSNHKQHLKVHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368
C2H2 Zn finger 322..342 CDD:275368
zf-H2C2_2 334..359 CDD:290200
COG5048 336..769 CDD:227381
zf-C2H2 348..370 CDD:278523
C2H2 Zn finger 350..370 CDD:275368
C2H2 Zn finger 378..398 CDD:275368
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368 69/256 (27%)
C2H2 Zn finger 1049..1069 CDD:275368 8/19 (42%)
C2H2 Zn finger 1197..1217 CDD:275368 6/19 (32%)
C2H2 Zn finger 1229..1246 CDD:275368 4/18 (22%)
C2H2 Zn finger 1258..1278 CDD:275368 6/19 (32%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 8/19 (42%)
zf-H2C2_2 113..138 CDD:290200 7/25 (28%)
C2H2 Zn finger 129..149 CDD:275368 5/19 (26%)
zf-H2C2_2 142..166 CDD:290200 7/26 (27%)
COG5048 151..>264 CDD:227381 33/140 (24%)
C2H2 Zn finger 157..177 CDD:275368 4/19 (21%)
C2H2 Zn finger 185..206 CDD:275368 7/34 (21%)
C2H2 Zn finger 235..255 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..285 CDD:275368 5/21 (24%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.