DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oaz and CG11398

DIOPT Version :9

Sequence 1:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:379 Identity:78/379 - (20%)
Similarity:122/379 - (32%) Gaps:114/379 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 VDAEEPEDLEL-----DDELLSLSGDEDYDDEELQSLDSFYSDMYSTHTSSSYSPSI-------- 184
            |..:|.|.|.|     :||.|||: .|:...|||..        .|.|.... |||.        
  Fly     4 VQYKEAEILALLPHTYEDEELSLN-TEELQFEELNE--------RSQHQQGG-SPSFVCRRCPAL 58

  Fly   185 ----------------SDGTMTPNSHHLIGAPTAAGQEDHPTEGKINGGADGEDLPKPKRLPHFH 233
                            ..|..||.|.|...|.....|:.:.....:|...|..:.|.|:....|.
  Fly    59 FLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYPCPECPARFV 123

  Fly   234 HHHHHHYHHQQALKIANKLRKINKEAKMGATAGGGATGAASKFDKLTGEGIKSRGDGSYQCQFCE 298
            ...:...|          |:.::::..:.:....|                            |:
  Fly   124 QRSNRECH----------LKNVHRKVYLHSCPEPG----------------------------CK 150

  Fly   299 KTFPRLGYLKHHVQS-HAEHLPFKCEYCSKLFKHKRSRDRHKKLHTNERNYKCPHCEAAFSRSDH 362
            |.|.:......||:: |.......|:.||..|.|..:..:|...|.:.::|.||.|...|.|.::
  Fly   151 KRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPEN 215

  Fly   363 LKIHMKTHDIQKPFQCSMCNRGYNTAAALTSH------------MQKHKKNAAILAAGGNPNALN 415
            ..:|:..|.|.|.:.||:|...|.....|..|            .||.:.:.|:.|.       |
  Fly   216 RDVHLFVHSICKAYICSVCGADYMRRNQLIRHGLASGHHNDPIVRQKPQFSPALAAK-------N 273

  Fly   416 YSPRSTGSASA-----------SVSSNGSLQKRRYA------LALASDSSPSRM 452
            .|.||....|.           ::.|.|.|:..:::      ...|.|.:.|.:
  Fly   274 RSQRSAIDESQDEELQWLKGVDALDSAGYLENSQFSNTGKMTAIFAEDENESEL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 5/20 (25%)
C2H2 Zn finger 322..342 CDD:275368 6/19 (32%)
zf-H2C2_2 334..359 CDD:290200 7/24 (29%)
COG5048 336..769 CDD:227381 33/146 (23%)
zf-C2H2 348..370 CDD:278523 7/21 (33%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 7/31 (23%)
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 0/19 (0%)
C2H2 Zn finger 87..107 CDD:275368 3/19 (16%)
C2H2 Zn finger 115..136 CDD:275368 4/30 (13%)
C2H2 Zn finger 144..165 CDD:275368 6/48 (13%)
C2H2 Zn finger 175..195 CDD:275368 6/19 (32%)
C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..247 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.