DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oaz and Zfp64

DIOPT Version :9

Sequence 1:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster
Sequence 2:NP_033590.2 Gene:Zfp64 / 22722 MGIID:107342 Length:676 Species:Mus musculus


Alignment Length:587 Identity:122/587 - (20%)
Similarity:197/587 - (33%) Gaps:178/587 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EAEEGSEELQHPRDEVVASDAAANAN--GHCKSSGHEEDAVDAEEPEDLELDDELLSLSGDEDYD 157
            |.:..|..:|.|....|..:.|.:.:  |.||......||..|.:....:|....::......:.
Mouse     6 EGDTFSGSMQIPGGTTVLVELAPDIHICGLCKQHFSNLDAFVAHKQSGCQLTTTPVTAPSTVQFV 70

  Fly   158 DEELQSLDSFYSDMYSTHTSSSYSPSISDGTMTPNSHHLIGAPTAAGQEDH----PTEGKINGGA 218
            .||.:.         :|.|:::   :||..|.|..    :.||....:..:    |||...|..|
Mouse    71 AEETEP---------ATQTTTT---TISSETQTIT----VSAPEFVFEHGYQTYLPTESTDNQTA 119

  Fly   219 DGEDLP------KPKRLPHFHHHHHHHYHHQQALKIANKLRKINKEAKMGATAGGGATGAASKFD 277
            ....||      ||...|                          .:.::|....|      .:|.
Mouse   120 TVISLPTKSRTKKPTAPP--------------------------AQKRLGCCYPG------CQFK 152

  Fly   278 KLTGEGIKS--------RGDGSYQCQFCEKTFPRLGYLKHHVQSHAEHLPFKCEYCSKLFKHKRS 334
              |..|:|.        .||..::|:.|.|.|.|...||.|::.|....|:||:.|........|
Mouse   153 --TAYGMKDMERHLKIHTGDKPHKCEVCGKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSS 215

  Fly   335 RDRHKKLHTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQKPFQCSMCNRGYNTAAALTSHMQKHK 399
            .::|.::|::||.:||..|..|...|..|.:|:::|....||||.:|:..:..::.|..||:.| 
Mouse   216 LNKHLRIHSDERPFKCQICPYASRNSSQLTVHLRSHTGDAPFQCWLCSAKFKISSDLKRHMRVH- 279

  Fly   400 KNAAILAAGGNPNALNY-SPRSTGSASAS----VSSNGSLQKRRYALALASDSSPSRMDFPKRSR 459
                   :|..|....: :.|.|...:..    :..:|:..|..:...|....|..|    |.||
Mouse   280 -------SGEKPFKCEFCNVRCTMKGNLKSHIRIKHSGNNFKCPHCDFLGDSKSTLR----KHSR 333

  Fly   460 ---SNHVGGTTTTATPTPLLRCSY-CPKVTEFSSLEQLNAHLQSVH--EQPQTQAVKTPVQEGEG 518
               |.|         |.....||| |      ||...|..| :.:|  |:|              
Mouse   334 LHQSEH---------PEKCPECSYSC------SSKAALRVH-ERIHCTERP-------------- 368

  Fly   519 FQLSCEYCTMKFGNIAGLFQHMRSTHMDRLSSPNSYYEHFNRLATAGTFSPRLALDLPKIKPDLG 583
              ..|.||:......:.|.:||:..|.|.|.:.                                
Mouse   369 --FKCSYCSFDTKQPSNLSKHMKKFHADMLKNE-------------------------------- 399

  Fly   584 SPERESRPAEDDLPTDLSNNKRRPLTPNPQAQTPLAPPSAPPGVFFCNQCNAGLPDFESFRNHLK 648
            :||::....:........:.|:                     .|.|:.|:|.....:|.|:|.:
Mouse   400 APEKKESGRQSSRQVARLDAKK---------------------TFHCDICDASFMREDSLRSHKR 443

  Fly   649 SH 650
            .|
Mouse   444 QH 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 8/19 (42%)
C2H2 Zn finger 322..342 CDD:275368 4/19 (21%)
zf-H2C2_2 334..359 CDD:290200 9/24 (38%)
COG5048 336..769 CDD:227381 67/326 (21%)
zf-C2H2 348..370 CDD:278523 7/21 (33%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 5/19 (26%)
C2H2 Zn finger 630..650 CDD:275368 6/19 (32%)
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
Zfp64NP_033590.2 COG5048 <149..448 CDD:227381 87/396 (22%)
zf-H2C2_2 159..184 CDD:290200 6/24 (25%)
C2H2 Zn finger 175..195 CDD:275368 8/19 (42%)
zf-H2C2_2 188..209 CDD:290200 8/20 (40%)
C2H2 Zn finger 203..223 CDD:275368 4/19 (21%)
zf-H2C2_2 215..237 CDD:290200 8/21 (38%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
C2H2 Zn finger 259..279 CDD:275368 5/19 (26%)
zf-H2C2_2 271..295 CDD:290200 7/31 (23%)
C2H2 Zn finger 287..306 CDD:275368 2/18 (11%)
C2H2 Zn finger 343..363 CDD:275368 8/26 (31%)
zf-H2C2_2 355..380 CDD:290200 8/41 (20%)
C2H2 Zn finger 371..389 CDD:275368 5/17 (29%)
zf-C2H2_6 422..448 CDD:290623 8/24 (33%)
C2H2 Zn finger 425..445 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.