DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Achl and La1

DIOPT Version :9

Sequence 1:NP_001286419.1 Gene:Achl / 36605 FlyBaseID:FBgn0033936 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_567904.1 Gene:La1 / 829408 AraportID:AT4G32720 Length:433 Species:Arabidopsis thaliana


Alignment Length:274 Identity:72/274 - (26%)
Similarity:115/274 - (41%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 IP--SEELAAEITDAVEFYFSNESILKDAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTR------ 332
            ||  :||.|..:...||||||:.::..|.||.|.|..:::|.|||.|:.||.::|...:      
plant     3 IPCLTEETAKTVLRQVEFYFSDSNLPIDDFLKKTVTESEDGLVSLALICSFSKMRGYLKLGDSKG 67

  Fly   333 ------EWKVVGDAVRRKSRKIELNDVGTKVRRIEPLPSFD---ETMPSRTIVACDLPLDKLTIE 388
                  ..|.|.|.:|..| .::::|.|.||.|...|...:   |.:.:||:.|.....| :..|
plant    68 DDIPEDTIKAVADTLRTSS-ALKISDDGKKVGRSTELLKLEDLIEQLNARTVAASPFSYD-VKRE 130

  Fly   389 KVSDLFSPCGEIALIRILKPGMAIPVDVRQFMNKYPELQQKECALVEYLESSSARDARHLNGPFQ 453
            .|...||..|::..:|:.:.    ..:.|.|..         .||||:.....|::....|..|.
plant   131 DVESFFSQYGKVNSVRMPRH----VAESRIFSG---------VALVEFPTEEDAQNVMKQNLVFA 182

  Fly   454 VYEM-VAPKKKTGKKAAVIQIAAPVARMVENYRYYND---ANYERSRGG----SFSGHETVPDLR 510
            ..|: :.|||:                 .:|.|..::   |||:..:|.    :.|.|       
plant   183 GQELELKPKKE-----------------FDNEREKDEVKFANYQPQKGSANQKNGSDH------- 223

  Fly   511 FKLKRNNSDFQPSY 524
                :|||.::|.|
plant   224 ----KNNSAYEPDY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AchlNP_001286419.1 LARP_6 282..359 CDD:153402 29/88 (33%)
RRM_LARP6 373..472 CDD:240735 23/99 (23%)
La1NP_567904.1 LA_like_plant 10..99 CDD:153399 29/89 (33%)
RRM1_La 117..189 CDD:409733 19/85 (22%)
RRM_SF 316..388 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3569
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.