DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Achl and SSB

DIOPT Version :9

Sequence 1:NP_001286419.1 Gene:Achl / 36605 FlyBaseID:FBgn0033936 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_001281074.1 Gene:SSB / 6741 HGNCID:11316 Length:408 Species:Homo sapiens


Alignment Length:298 Identity:59/298 - (19%)
Similarity:131/298 - (43%) Gaps:34/298 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 LAAEITDAVEFYFSNESILKDAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAV-RRK 344
            |.|:|...:|:||.:.::.:|.||.:.::.: ||:|.|:::..|.|:.:||.::.|:.:|: :.|
Human    13 LEAKICHQIEYYFGDFNLPRDKFLKEQIKLD-EGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSK 76

  Fly   345 SRKIELNDVGTKVRR--IEPLP----SFDETMPSRTIVACDLPLDKLTIEKVSDLFSPCGEI--- 400
            :..:|:::..||:||  .:|||    .:...:.:|::.....|.| .|::.:.:.....|::   
Human    77 AELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTD-ATLDDIKEWLEDKGQVLNI 140

  Fly   401 ----ALIRILKPGMAIPVDVRQFMNKY---PELQQKECALV------EYLESSSARDARHLNGPF 452
                .|.:..|..:.:..|..:...|:   |..:.||..|:      .:.:.:..|....:....
Human   141 QMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKL 205

  Fly   453 QVYEMVAPKKKTGKKAAVIQIAAPVARMVENYRYYNDANYERSRGGSFSGHETVPDLRF--KLKR 515
            :..:....|:|..:.|.:..:...:..:::.....:|..........||.|..:..:.|  ..|.
Human   206 RAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKE 270

  Fly   516 NNSDFQPSYYQQTGPSYHANPYQHYQPRGSIGNQNQEV 553
            ....|:....:..|.:..||       .|::..:|:||
Human   271 GIILFKEKAKEALGKAKDAN-------NGNLQLRNKEV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AchlNP_001286419.1 LARP_6 282..359 CDD:153402 22/77 (29%)
RRM_LARP6 373..472 CDD:240735 17/114 (15%)
SSBNP_001281074.1 LARP_3 10..91 CDD:153397 23/78 (29%)
RRM1_La 112..183 CDD:240737 12/71 (17%)
RRM_3 231..334 CDD:370115 14/78 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.