DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Achl and larp6b

DIOPT Version :9

Sequence 1:NP_001286419.1 Gene:Achl / 36605 FlyBaseID:FBgn0033936 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_001082877.1 Gene:larp6b / 565767 ZFINID:ZDB-GENE-041008-244 Length:471 Species:Danio rerio


Alignment Length:427 Identity:117/427 - (27%)
Similarity:194/427 - (45%) Gaps:128/427 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 PSEELAAEITDAVEFYFSNESILKDAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAV 341
            |::::..:|...:|.|.|:|::..||||||||:|||.|:|||||::|||::|.|||:|:.. .|.
Zfish    57 PNDDVTQQIATQLENYLSDENLSDDAFLLKHVQRNKMGYVSLKLLTSFKKIRDLTRDWRTT-LAA 120

  Fly   342 RRKSRKIELNDVGTKVRRIEPLPSFDETMP-SRTIVACDL--------------PLDKLTI-EKV 390
            .|.|.::|:|::||||||..|:|.:...:| |:.::|.:.              .:::|.| |..
Zfish   121 ARTSPQLEVNEMGTKVRRRTPVPDWLLCIPTSKLLLAWNFLDGAGPVKEKFESPGVEQLGIMEAA 185

  Fly   391 SDLFSPCGEIALIRILKPGMAIPVDVRQFMNKYPELQQKECALVEYLESSSARDARHLNGPFQVY 455
            ..:|||.|.|:.:|||:||..||.:::::..|:.||.:|.||:|||         .:|.|..:.:
Zfish   186 MRVFSPYGTISSLRILRPGKEIPAELKRYTKKHLELGRKVCAVVEY---------EYLEGARKAF 241

  Fly   456 EMVAPKKKTGKKAAVIQIAAPVARMVENYRYYNDANYERSRG----GSFSG-----HETVPDLRF 511
            |.:..:::.|.:...:.:..                   |||    |...|     .|...|:..
Zfish   242 EALKVEEQQGGRGICVVLLG-------------------SRGTRKPGCSQGLVDEEQEDCIDIDV 287

  Fly   512 KLKR--------------------NNSDFQPSYYQQT-----------GP-------SYHANPYQ 538
             |||                    :.|||.|:..:..           .|       ::.::||:
Zfish   288 -LKRPDRKARQFVYSLEDSAVCSSSESDFAPASPRPNRRVSRPQALYGSPLAIPRVSTFRSDPYR 351

  Fly   539 HYQPRGS-IGNQNQEVGPNGFFGYGPRRYSNTSTISANTAAALGDVSPISSAVNSGG-------- 594
            :  |.|| :|:..|           ||:....|.:::..|     ..|.||..:..|        
Zfish   352 N--PLGSPVGSPLQ-----------PRKLFPCSHVTSPLA-----THPFSSTPSGAGTSFKYKAS 398

  Fly   595 ---NPMVSGISS---LQRRLSNCSEQNYTPEVNPSMS 625
               :|...|.:|   :|||.:  :.|...||:..|||
Zfish   399 GELSPDDLGFTSSPWVQRRKN--AAQVIQPEMASSMS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AchlNP_001286419.1 LARP_6 282..359 CDD:153402 39/76 (51%)
RRM_LARP6 373..472 CDD:240735 29/113 (26%)
larp6bNP_001082877.1 LARP_6 62..138 CDD:153402 39/76 (51%)
RRM_SF 153..261 CDD:388407 29/116 (25%)
SUZ-C 445..459 CDD:372374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596350
Domainoid 1 1.000 73 1.000 Domainoid score I9211
eggNOG 1 0.900 - - E1_COG5193
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005698
OrthoInspector 1 1.000 - - otm25030
orthoMCL 1 0.900 - - OOG6_120975
Panther 1 1.100 - - O PTHR22792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3569
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.700

Return to query results.
Submit another query.