DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Achl and LARP7

DIOPT Version :9

Sequence 1:NP_001286419.1 Gene:Achl / 36605 FlyBaseID:FBgn0033936 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_001357903.1 Gene:LARP7 / 51574 HGNCID:24912 Length:595 Species:Homo sapiens


Alignment Length:388 Identity:90/388 - (23%)
Similarity:164/388 - (42%) Gaps:70/388 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 QEKEQEVPVHQEQDTEPQGPNEIDTLDPSLIPSEELAAEITDAVEFYFSNESILKDAFLLKHVRR 310
            |||     |.:|:.||.:  .|::....|.:  :::.|:|...|:|:|.:.::.||.||.:.:.:
Human     8 QEK-----VMEEESTEKK--KEVEKKKRSRV--KQVLADIAKQVDFWFGDANLHKDRFLREQIEK 63

  Fly   311 NKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRKSRKIELNDVGTKVRRIEPLPSFDETMPSRTI 375
            :::|:|.:.|:.||.::::||.:.|::..|: |.|..:||:..||::||.:||....:....||:
Human    64 SRDGYVDISLLVSFNKMKKLTTDGKLIARAL-RSSAVVELDLEGTRIRRKKPLGERPKDEDERTV 127

  Fly   376 VACDLP--LDKLTIEKVSDLFSPCGEIALIRILKPGMAIPVDVRQFMNKYPELQQKECA--LVEY 436
            ....||  ::...||:|   |..||.:..|.|  |......|.:.|  .:.|.:.||.|  .:|:
Human   128 YVELLPKNVNHSWIERV---FGKCGNVVYISI--PHYKSTGDPKGF--AFVEFETKEQAAKAIEF 185

  Fly   437 LESSSARDARH--------LNGPFQVYEMVAPKKKTGKKAAVIQIAAPVARMVENYRYYNDANYE 493
            |.:......|.        .|.|.....:|..|||..||..               |...:.|.:
Human   186 LNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKG---------------RMKKEDNIQ 235

  Fly   494 RSRGGSFSGHETVPDLRFKLKRNNSDFQPSYYQQTGPSYHANPYQHYQPRGSIGNQNQEVGPNGF 558
            .......:.:.::.    |:||:....:.|..:.|.|....:..:..:.|.. .:...||..   
Human   236 AKEENMDTSNTSIS----KMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVE-ASSLPEVRT--- 292

  Fly   559 FGYGPRRYSNTSTISANTAAALGDVSPISSAVNSGGNPMVSGISSLQRRLSNCSEQNYTPEVN 621
               |.|:.|     |:..|.:|...|.:...:.          ..:.:..|..|::|..|.:|
Human   293 ---GKRKRS-----SSEDAESLAPRSKVKKIIQ----------KDIIKEASEASKENRAPCLN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AchlNP_001286419.1 LARP_6 282..359 CDD:153402 24/76 (32%)
RRM_LARP6 373..472 CDD:240735 30/110 (27%)
LARP7NP_001357903.1 LARP_7 30..111 CDD:153401 24/83 (29%)
RRM <117..300 CDD:223796 44/220 (20%)
RRM1_LARP7 126..205 CDD:240736 21/85 (25%)
RRM_3 467..565 CDD:370115
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.