DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Achl and Larp1b

DIOPT Version :9

Sequence 1:NP_001286419.1 Gene:Achl / 36605 FlyBaseID:FBgn0033936 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_001035489.2 Gene:Larp1b / 214048 MGIID:1914604 Length:541 Species:Mus musculus


Alignment Length:423 Identity:85/423 - (20%)
Similarity:146/423 - (34%) Gaps:127/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVDPTPILAPILTAVPVMKAPDSPASMDKTKEMEELDDEQPSCSSQAVVPLSSSLPCKLLRMHAR 94
            |..|.|.|.|.....|...|.:.||:..        .:::|........|.:..||..|..:...
Mouse   113 PPPPPPPLPPPAPRDPPEDAREDPAAAG--------PEDKPPPPPPKGNPWTKKLPQHLSTVGTG 169

  Fly    95 RSAQALLHQMESMDSQLGSSN----GSTSEDTSPSAPPMS-----PTDHQLVDVGMGSSIGD--- 147
            ..:.|    .:|.:::|.|..    |......|..|...|     ||..:||:.|..|.|..   
Mouse   170 VPSPA----QDSPEAELSSPKIIKAGKLKTKKSNKASDFSDMANWPTPGELVNTGSQSVINQGNK 230

  Fly   148 ---------------SDESSEEGDELKPLAVDNHIIAEVDLTERQTTPPAVLSEANLEKFRKHQM 197
                           |:..|:|..|           |::|......:.....|.:..::..||:.
Mouse   231 KPQIRKEKEEKIEKRSNSESKENRE-----------AKLDGPTENISEDEAQSSSQRKRANKHKW 284

  Fly   198 DNIYLHPNFTLDASPPPAVAP-----------ANSPVLEAKRTHRSFLTMKKEKEVEPPQEKEQE 251
            ..::|.     |..|.....|           ||.|.    .::|...|....:|.|...::::.
Mouse   285 VPLHLD-----DVRPDSQERPGSRNSSRCQPEANKPT----HSNRKSDTRSWRREREKRDDQDEV 340

  Fly   252 VPVHQE----------------------------------------QDTEPQGPNEIDT------ 270
            ..|..|                                        :.||.....|::|      
Mouse   341 SSVRSEGGTIRGSTRGRGRGRGRGRGRGRGNPRLNFDYSYGYREPGERTEQPFSTELNTSMMYYY 405

  Fly   271 ---LDPSLIPSEE--LAAEITDAVEFYFSNESILKDAFLLKHVRRNKEGFVSLKLVSSFKRVRQL 330
               ....:.|.||  |...|...:|:|||.|::.:|.||.:  :.:::||:.:.|::.|.||:.|
Mouse   406 DDGTGVRVYPVEETLLKEYIKRQIEYYFSTENLERDFFLRR--KMDEQGFLPISLIAGFHRVQAL 468

  Fly   331 TREWKVVGDAVRRKSRKIELNDVGTKVR-RIEP 362
            |....::.:|: :.|.::|:  |..|:| :|||
Mouse   469 TTNLNLILEAL-KDSTEVEI--VDEKMRKKIEP 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AchlNP_001286419.1 LARP_6 282..359 CDD:153402 23/77 (30%)
RRM_LARP6 373..472 CDD:240735
Larp1bNP_001035489.2 LARP_2 422..494 CDD:153407 22/76 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.