DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17385 and ZNF502

DIOPT Version :9

Sequence 1:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001127912.1 Gene:ZNF502 / 91392 HGNCID:23718 Length:544 Species:Homo sapiens


Alignment Length:222 Identity:78/222 - (35%)
Similarity:125/222 - (56%) Gaps:8/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKA 82
            |..|.:||::|.:.:.| |.:|:..| .|:||.|.|:||.|.:|.:|.::|...:|:.|..|.||
Human   325 CDECGKTFQTKANLSQH-QRIHSGEK-PYKCKECGKAFCQSPSLIKHQRIHTGEKPYKCKECGKA 387

  Fly    83 FAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKK 147
            |.|:..|.:|..:|:||||:.|:.|.|:|.|...:.||:.:||||||::|..||:.|:|...|.:
Human   388 FTQSTPLTKHQRIHTGERPYKCSECGKAFIQSICLIRHQRSHTGEKPYKCNECGKGFNQNTCLTQ 452

  Fly   148 HKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGV--DVDVPASIQAAAALARE-RLESEQK 209
            |...|...|||:|..|.|.|...|:...|.::|..|.:  ..:...:.:..|.|:.. |:.:.:|
Human   453 HMRIHTGEKPYKCKECGKAFAHSSSLTEHHRTHTGEKLYKCSECEKTFRKYAHLSEHYRIHTGEK 517

  Fly   210 PSFFECMVCRAIFDTFADYEKHEAKCH 236
            |  :||:.|...|...:...:|: |.|
Human   518 P--YECIECGKFFRHSSVLFRHQ-KLH 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 64/162 (40%)
C2H2 Zn finger 18..39 CDD:275368 7/20 (35%)
C2H2 Zn finger 48..68 CDD:275368 9/19 (47%)
C2H2 Zn finger 76..96 CDD:275368 8/19 (42%)
C2H2 Zn finger 104..124 CDD:275368 7/19 (37%)
C2H2 Zn finger 132..148 CDD:275368 6/15 (40%)
C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
ZNF502NP_001127912.1 COG5048 151..538 CDD:227381 75/216 (35%)
C2H2 Zn finger 157..177 CDD:275368
C2H2 Zn finger 185..205 CDD:275368
C2H2 Zn finger 213..233 CDD:275368
C2H2 Zn finger 241..261 CDD:275368
C2H2 Zn finger 269..289 CDD:275368
C2H2 Zn finger 297..317 CDD:275368
C2H2 Zn finger 325..345 CDD:275368 7/20 (35%)
C2H2 Zn finger 353..373 CDD:275368 9/19 (47%)
C2H2 Zn finger 381..401 CDD:275368 8/19 (42%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
C2H2 Zn finger 437..457 CDD:275368 7/19 (37%)
C2H2 Zn finger 465..485 CDD:275368 6/19 (32%)
C2H2 Zn finger 493..513 CDD:275368 3/19 (16%)
C2H2 Zn finger 521..541 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.