DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17385 and ZBTB26

DIOPT Version :9

Sequence 1:	NP_001286418.1	Gene:	CG17385 / 36603	FlyBaseID:	FBgn0033934	Length:	278	Species:	Drosophila melanogaster
Sequence 2:	NP_001291292.1	Gene:	ZBTB26 / 57684	HGNCID:	23383	Length:	441	Species:	Homo sapiens

Alignment Length:	116	Identity:	46/116 - (39%)
Similarity:	65/116 - (56%)	Gaps:	11/116 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 CKRCDRTFRSKRDQTLHRQEVHNHNK--TTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICS 80
            |.:|.|.||       |.:...||.|  ..:.|.||.|:|...|||.|||:||..::||.|.||.
Human   275 CPKCTRVFR-------HLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICG 332

  Fly    81 KAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRH-KMTHTGEKPF 130
            |.|:|..:||.|..:|||::|..||:|:..|..:..:::| |..| |:..|
Human   333 KTFSQKCSLQDHLNLHSGDKPHKCNYCDMVFAHKPVLRKHLKQLH-GKNSF 382

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17385	NP_001286418.1	COG5048	<13..181	CDD:227381	46/116 (40%)
		C2H2 Zn finger	18..39	CDD:275368	6/20 (30%)
		C2H2 Zn finger	48..68	CDD:275368	11/19 (58%)
		C2H2 Zn finger	76..96	CDD:275368	9/19 (47%)
		C2H2 Zn finger	104..124	CDD:275368	6/20 (30%)
		C2H2 Zn finger	132..148	CDD:275368
		C2H2 Zn finger	160..180	CDD:275368
ZBTB26	NP_001291292.1	BTB_POZ_ZBTB26_Bioref	8..129	CDD:349523
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	134..177
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	194..216
		COG5236	<269..>381	CDD:227561	45/113 (40%)
		C2H2 Zn finger	275..295	CDD:275368	9/26 (35%)
		zf-C2H2	298..320	CDD:395048	11/21 (52%)
		C2H2 Zn finger	300..320	CDD:275368	11/19 (58%)
		zf-H2C2_2	315..337	CDD:404364	12/21 (57%)
		C2H2 Zn finger	328..348	CDD:275368	9/19 (47%)
		C2H2 Zn finger	356..374	CDD:275368	5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0005566
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.000