| Sequence 1: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001013303.1 | Gene: | zgc:110821 / 503597 | ZFINID: | ZDB-GENE-050227-8 | Length: | 279 | Species: | Danio rerio |
| Alignment Length: | 251 | Identity: | 67/251 - (26%) |
|---|---|---|---|
| Similarity: | 96/251 - (38%) | Gaps: | 89/251 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 48 CKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFT 112
Fly 113 QQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKH----------------------------- 148
Fly 149 ------------------KLG---------------HLNAKPYQCNYCEKGFTQLSNFKRHLQSH 180
Fly 181 IKEGVDVDVPASIQAAAALARERLESEQKPSFFECMVCRAIFDTFADYEKHEAKCH 236 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 58/194 (30%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | |||
| C2H2 Zn finger | 48..68 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 6/15 (40%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 8/19 (42%) | ||
| zgc:110821 | NP_001013303.1 | ROS_MUCR | <49..>76 | CDD:303058 | 12/24 (50%) |
| C2H2 Zn finger | 51..71 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 79..99 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 92..115 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 107..127 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 119..144 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 135..156 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 197..217 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 210..234 | CDD:290200 | 9/23 (39%) | ||
| COG5048 | 221..>269 | CDD:227381 | 18/74 (24%) | ||
| C2H2 Zn finger | 225..245 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 237..262 | CDD:290200 | 10/51 (20%) | ||
| C2H2 Zn finger | 253..269 | CDD:275368 | 3/15 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||