DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17385 and zgc:100951

DIOPT Version :9

Sequence 1:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001003622.1 Gene:zgc:100951 / 445228 ZFINID:ZDB-GENE-040801-141 Length:171 Species:Danio rerio


Alignment Length:183 Identity:60/183 - (32%)
Similarity:87/183 - (47%) Gaps:22/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VEFDETVANQFSCKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKVHND 70
            ::.:|| ..|...|..::    :.:|||.:....:|        |..:.|.:..:.||     ||
Zfish     9 IKLEET-EEQTDLKENEK----REEQTLVKARKTSH--------LLTEGFLSMKSEDR-----ND 55

  Fly    71 VRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRC 135
               |.|:.|.|:.....:|:.|..:|:||:||||..|.|.|...||:..|.:.|||||..:|.:|
Zfish    56 ---FTCSQCGKSLRGKQSLKIHMRIHTGEKPFTCTQCGKRFRVLSNLNLHMLIHTGEKTHKCDQC 117

  Fly   136 GRYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQS-HIKEGVDV 187
            |:.|.:...||||...|...|||.|:.|.|.|.....||...:. |..|.|.|
Zfish   118 GKTFLRASELKKHLRVHTKEKPYSCSECGKSFFTADKFKNTSEDPHWCERVSV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 54/168 (32%)
C2H2 Zn finger 18..39 CDD:275368 4/20 (20%)
C2H2 Zn finger 48..68 CDD:275368 4/19 (21%)
C2H2 Zn finger 76..96 CDD:275368 5/19 (26%)
C2H2 Zn finger 104..124 CDD:275368 7/19 (37%)
C2H2 Zn finger 132..148 CDD:275368 6/15 (40%)
C2H2 Zn finger 160..180 CDD:275368 6/20 (30%)
zgc:100951NP_001003622.1 C2H2 Zn finger 58..78 CDD:275368 5/19 (26%)
zf-H2C2_2 70..93 CDD:290200 11/22 (50%)
C2H2 Zn finger 86..106 CDD:275368 7/19 (37%)
zf-H2C2_2 98..123 CDD:290200 11/24 (46%)
C2H2 Zn finger 114..134 CDD:275368 8/19 (42%)
zf-H2C2_2 126..149 CDD:290200 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.