DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17385 and Sry-beta

DIOPT Version :9

Sequence 1:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:240 Identity:56/240 - (23%)
Similarity:91/240 - (37%) Gaps:40/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GMEVEFDETVANQFSCKRCDRTFR-SKRDQTLHRQEVHNHNKTT-YECKLCAKSFCNSGNLDRHM 65
            |.|.|.:|.:..:.    .|..|: |:.|.::...|.....:|| ..|.:|.:.|.:...|:||:
  Fly   130 GEEDECEEFMKEEM----LDEEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHI 190

  Fly    66 KVH--NDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEK 128
            |..  .......||:|.........|..|..:|.|:....|.:|:|.|:.:.|:.||...|..:|
  Fly   191 KADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKK 255

  Fly   129 PFRCQRCGRYFSQLVNLKKHKLGH-LNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGVDVDVPAS 192
            .::|.:||..||....:..|.:.| .......|..|.:.|.....:|.||::|     ..|.|. 
  Fly   256 KYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRTYKHHLRTH-----QTDRPR- 314

  Fly   193 IQAAAALARERLESEQKPSFFECMVCRAIFDTFADYEKHEAKCHE 237
                                :.|..|...|     .:|:..|.|:
  Fly   315 --------------------YPCPDCEKSF-----VDKYTLKVHK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 43/172 (25%)
C2H2 Zn finger 18..39 CDD:275368 5/21 (24%)
C2H2 Zn finger 48..68 CDD:275368 7/19 (37%)
C2H2 Zn finger 76..96 CDD:275368 5/19 (26%)
C2H2 Zn finger 104..124 CDD:275368 7/19 (37%)
C2H2 Zn finger 132..148 CDD:275368 5/15 (33%)
C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 13/48 (27%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 6/25 (24%)
C2H2 Zn finger 317..337 CDD:275368 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.