| Sequence 1: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_732827.1 | Gene: | CG31365 / 42736 | FlyBaseID: | FBgn0051365 | Length: | 639 | Species: | Drosophila melanogaster |
| Alignment Length: | 202 | Identity: | 56/202 - (27%) |
|---|---|---|---|
| Similarity: | 91/202 - (45%) | Gaps: | 38/202 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 TYECKLCAKSFCNSGNLDRHMKVH------NDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFT 103
Fly 104 CNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKHKLGHL---NAKPYQCNYCEK 165
Fly 166 GFTQLSNFKRHLQSHIKEGVDVDVPASIQAAAALARERLESEQKPSFFECMVCRAIFDTFADYEK 230
Fly 231 HEAKCHE 237 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 47/144 (33%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | |||
| C2H2 Zn finger | 48..68 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 6/15 (40%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 7/19 (37%) | ||
| CG31365 | NP_732827.1 | zf-AD | 13..86 | CDD:214871 | |
| vATP-synt_E | 109..>244 | CDD:304907 | |||
| RRF | <161..222 | CDD:294170 | |||
| zf-C2H2_8 | 454..530 | CDD:292531 | 23/75 (31%) | ||
| C2H2 Zn finger | 485..505 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 497..522 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 513..533 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 526..550 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 541..562 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 571..591 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 598..617 | CDD:275368 | 4/18 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45446659 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||