| Sequence 1: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097659.1 | Gene: | CG11247 / 40414 | FlyBaseID: | FBgn0037120 | Length: | 522 | Species: | Drosophila melanogaster |
| Alignment Length: | 249 | Identity: | 78/249 - (31%) |
|---|---|---|---|
| Similarity: | 110/249 - (44%) | Gaps: | 49/249 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 VEFDETVANQFSCKRCDRTFRSKRDQTLHRQ-----------------------EVH----NHNK 43
Fly 44 TTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCN 108
Fly 109 KSFTQQSNMKRHKMTHTGEKPFRCQRCGR--YFSQLVNLKKH-KLGHLNAKPYQCNYCEKGFTQL 170
Fly 171 SNFKRHLQSHI----KEGVDVDVPASIQAA-----------AALARERLESEQK 209 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 65/197 (33%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | 4/43 (9%) | ||
| C2H2 Zn finger | 48..68 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 9/17 (53%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 6/19 (32%) | ||
| CG11247 | NP_001097659.1 | COG5048 | <88..247 | CDD:227381 | 8/48 (17%) |
| C2H2 Zn finger | 95..115 | CDD:275368 | |||
| zf-H2C2_2 | 107..132 | CDD:290200 | |||
| C2H2 Zn finger | 123..144 | CDD:275368 | |||
| C2H2 Zn finger | 152..172 | CDD:275368 | |||
| zf-H2C2_2 | 165..189 | CDD:290200 | |||
| C2H2 Zn finger | 180..200 | CDD:275368 | 1/1 (100%) | ||
| COG5048 | <192..369 | CDD:227381 | 54/170 (32%) | ||
| C2H2 Zn finger | 210..230 | CDD:275370 | 4/19 (21%) | ||
| C2H2 Zn finger | 238..260 | CDD:275371 | 1/21 (5%) | ||
| C2H2 Zn finger | 267..287 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 295..315 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 309..332 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 323..343 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 351..374 | CDD:275368 | 11/22 (50%) | ||
| C2H2 Zn finger | 382..399 | CDD:275368 | 7/20 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45446662 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||