DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17385 and CG7386

DIOPT Version :9

Sequence 1:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster


Alignment Length:245 Identity:62/245 - (25%)
Similarity:89/245 - (36%) Gaps:99/245 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TVANQFSCKRCDRTFRSKRDQTLHRQEVHNH---------NKT---TY---------------EC 48
            |..|||.|:.||....:||....|.:.||..         .||   .|               ||
  Fly   372 TQRNQFKCRICDYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCEC 436

  Fly    49 KLCAKSFCNSGNLDRHMKVHND------------------------------------------- 70
            |:|.|.|.:|.:|:.|:|:|..                                           
  Fly   437 KVCDKKFLHSESLNNHLKIHEKSVERALETYKQVQVNGDASDTQVDSHQLLKVYAESVASIPKNP 501

  Fly    71 ---------------VRP------------FVCNICSKAFAQAVNLQRHY-AVHSGERPFTCNFC 107
                           |.|            ::|..||:.|....|::||| :||...:.|.|.||
  Fly   502 RRVEQVDVALLAGTAVNPTDEIQFVQKEGMYLCPSCSQGFKSIGNMKRHYKSVHEKVKDFECRFC 566

  Fly   108 NKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKHKLGHLNAKP 157
            ::.|....::|:|:..|||||||.|:.||..|.|:..|.:|:..| :.||
  Fly   567 SRRFANSQSVKQHEWIHTGEKPFECKTCGNRFRQVAALIRHQKVH-DEKP 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 61/243 (25%)
C2H2 Zn finger 18..39 CDD:275368 6/20 (30%)
C2H2 Zn finger 48..68 CDD:275368 9/19 (47%)
C2H2 Zn finger 76..96 CDD:275368 8/20 (40%)
C2H2 Zn finger 104..124 CDD:275368 6/19 (32%)
C2H2 Zn finger 132..148 CDD:275368 6/15 (40%)
C2H2 Zn finger 160..180 CDD:275368
CG7386NP_648036.1 zf-AD 10..81 CDD:214871
C2H2 Zn finger 197..217 CDD:275368
C2H2 Zn finger 294..314 CDD:275368
C2H2 Zn finger 323..343 CDD:275368
C2H2 Zn finger 351..371 CDD:275368
C2H2 Zn finger 379..400 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..428 CDD:275368 3/19 (16%)
C2H2 Zn finger 436..456 CDD:275368 9/19 (47%)
C2H2 Zn finger 534..555 CDD:275368 8/20 (40%)
C2H2 Zn finger 563..583 CDD:275368 6/19 (32%)
zf-H2C2_2 575..600 CDD:290200 13/24 (54%)
C2H2 Zn finger 591..611 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.