| Sequence 1: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_477304.1 | Gene: | D19A / 38718 | FlyBaseID: | FBgn0022935 | Length: | 845 | Species: | Drosophila melanogaster |
| Alignment Length: | 289 | Identity: | 77/289 - (26%) |
|---|---|---|---|
| Similarity: | 107/289 - (37%) | Gaps: | 59/289 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3 GMEVEFDET---VANQFSC--KRCDRTFRSKRDQTLHRQEVHNHNKTT-----YECKLCAKSFCN 57
Fly 58 SGNLDRHMKVH-NDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHK 121
Fly 122 MTHTGEKPFRCQRCGRYFSQLVNLKKH-KLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGV 185
Fly 186 DVDVPASIQAAAALARERLESEQKPSFFECMVCRAIFDTFADYEKHEAKCHEDHE-------RAQ 243
Fly 244 LEV---NQMS---------HMHPDDYLPM 260 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 53/176 (30%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | 7/22 (32%) | ||
| C2H2 Zn finger | 48..68 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 3/15 (20%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 7/19 (37%) | ||
| D19A | NP_477304.1 | zf-AD | 12..83 | CDD:214871 | |
| C2H2 Zn finger | 343..362 | CDD:275368 | 6/18 (33%) | ||
| C2H2 Zn finger | 377..397 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 389..414 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 406..426 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 434..454 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 462..483 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 491..511 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 519..539 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 652..673 | CDD:275368 | |||
| C2H2 Zn finger | 681..701 | CDD:275368 | |||
| zf-H2C2_2 | 694..718 | CDD:290200 | |||
| C2H2 Zn finger | 709..729 | CDD:275368 | |||
| tolA_full | 724..>814 | CDD:274303 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45449754 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||