DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17385 and ZK686.5

DIOPT Version :9

Sequence 1:	NP_001286418.1	Gene:	CG17385 / 36603	FlyBaseID:	FBgn0033934	Length:	278	Species:	Drosophila melanogaster
Sequence 2:	NP_001023030.2	Gene:	ZK686.5 / 3565160	WormBaseID:	WBGene00022795	Length:	263	Species:	Caenorhabditis elegans

Alignment Length:	99	Identity:	34/99 - (34%)
Similarity:	53/99 - (53%)	Gaps:	8/99 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 MEVEFDETVANQFSCKRCDRTFRSKRDQTLHRQEVHNHNKTTY-ECKLCAKSFCNSGNLDRHMKV 67
            |:.:..||:...: |:.|::.|.|.:...|||.:|||   |.| ||.||.|.|..:...:||||.
Worm   160 MKRKVTETIVTTY-CELCEQNFSSSKMLLLHRGKVHN---TPYIECHLCMKLFSQTIQFNRHMKT 220

  Fly    68 H--NDVRPFV-CNICSKAFAQAVNLQRHYAVHSG 98
            |  .:.:.:| |.:|.:.|....:|:.|:.|..|
Worm   221 HYGPNAKIYVQCELCDRQFKDKQSLRTHWDVSHG 254

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17385	NP_001286418.1	COG5048	<13..181	CDD:227381	31/90 (34%)
		C2H2 Zn finger	18..39	CDD:275368	7/20 (35%)
		C2H2 Zn finger	48..68	CDD:275368	9/19 (47%)
		C2H2 Zn finger	76..96	CDD:275368	5/19 (26%)
		C2H2 Zn finger	104..124	CDD:275368
		C2H2 Zn finger	132..148	CDD:275368
		C2H2 Zn finger	160..180	CDD:275368
ZK686.5	NP_001023030.2	C2H2 Zn finger	173..194	CDD:275368	7/20 (35%)
		C2H2 Zn finger	201..221	CDD:275368	9/19 (47%)
		zf-C2H2_8	<204..251	CDD:292531	14/46 (30%)
		C2H2 Zn finger	232..248	CDD:275368	4/15 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	2	1.870