| Sequence 1: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_502594.2 | Gene: | fezf-1 / 3564888 | WormBaseID: | WBGene00012639 | Length: | 218 | Species: | Caenorhabditis elegans |
| Alignment Length: | 196 | Identity: | 69/196 - (35%) |
|---|---|---|---|
| Similarity: | 91/196 - (46%) | Gaps: | 27/196 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 HNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCN 105
Fly 106 FCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQL 170
Fly 171 SNFKRHLQSHIKEGVDVDVPASIQAAAALARERLESEQKPSFFECMVCRAIFDTFADYEKHEAKC 235
Fly 236 H 236 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 55/139 (40%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | |||
| C2H2 Zn finger | 48..68 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 7/15 (47%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 6/19 (32%) | ||
| fezf-1 | NP_502594.2 | COG5048 | <13..212 | CDD:227381 | 67/191 (35%) |
| DUF3449 | <50..>70 | CDD:288759 | 6/19 (32%) | ||
| C2H2 Zn finger | 54..74 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 66..91 | CDD:290200 | 16/24 (67%) | ||
| C2H2 Zn finger | 82..102 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 110..130 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 138..158 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 166..186 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 194..212 | CDD:275368 | 7/17 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 134 | 1.000 | Inparanoid score | I3159 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||