| Sequence 1: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster |
| Alignment Length: | 195 | Identity: | 62/195 - (31%) |
|---|---|---|---|
| Similarity: | 97/195 - (49%) | Gaps: | 16/195 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 18 CKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMK-VHNDVRPFVCNICSK 81
Fly 82 AFAQAVNLQRHYAVHSGE---RPFTCNFCNKSFTQQSNMKRHKMTHTG--EKPFRCQRCGRYFSQ 141
Fly 142 LVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGVDVDVPASIQAAAALARERLES 206
Fly 207 206 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 56/168 (33%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 48..68 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 5/15 (33%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 6/19 (32%) | ||
| CG30431 | NP_610211.1 | zf-AD | 11..82 | CDD:285071 | |
| C2H2 Zn finger | 234..255 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 264..285 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 293..313 | CDD:275368 | 5/19 (26%) | ||
| zf-C2H2_8 | 305..373 | CDD:292531 | 23/67 (34%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 354..374 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 366..389 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 382..403 | CDD:275368 | 6/23 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45446658 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||