DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17385 and CG17328

DIOPT Version :9

Sequence 1:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:214 Identity:60/214 - (28%)
Similarity:90/214 - (42%) Gaps:55/214 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGR 137
            |..|..|.|:|.....|.:|...|:||:|:.|:||.:.|.|:.|:|.|:.||||:|||:|:.|.:
  Fly   146 PHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSK 210

  Fly   138 YFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSH--IKEGVDVDVPASIQAAAALA 200
            .||.|.|.:.|:..||..:...|:.|:|||....:..:|:.:|  ||.                 
  Fly   211 QFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKN----------------- 258

  Fly   201 RERLESEQKPSFFECMVCRAIFDTFADYEKHEAKCH------------EDHERA----QLEVNQM 249
                        ..|.||...|....|...|:.|.|            :|.:.|    .:.::.:
  Fly   259 ------------HHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAIDTDPVGLDTL 311

  Fly   250 SHMHPDDYLPMKFAVPDLD 268
            .|.|        |..||.|
  Fly   312 DHAH--------FKCPDCD 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 42/109 (39%)
C2H2 Zn finger 18..39 CDD:275368
C2H2 Zn finger 48..68 CDD:275368
C2H2 Zn finger 76..96 CDD:275368 6/19 (32%)
C2H2 Zn finger 104..124 CDD:275368 8/19 (42%)
C2H2 Zn finger 132..148 CDD:275368 6/15 (40%)
C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 28/64 (44%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 8/19 (42%)
zf-H2C2_2 189..213 CDD:404364 12/23 (52%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 8/53 (15%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.