DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17385 and Plzf

DIOPT Version :9

Sequence 1:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:255 Identity:64/255 - (25%)
Similarity:98/255 - (38%) Gaps:35/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKA 82
            |..|:..|...|:...|.:......:..:.|..|...|.....|..|...|:...|.:|..|.|.
  Fly   214 CSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKG 278

  Fly    83 FAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRC--QRCGRYFSQLVNL 145
            |.....|..|..||:.|:...|:.|..|.|....:|.||:.||||. |.|  ..|....::..||
  Fly   279 FKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGEF-FACTVSGCKHRANRKENL 342

  Fly   146 KKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGVDVDVPASIQAAAALARERLESEQKP 210
            |.|...|...:.:.|..|...|:|..|.|||...|.:.|                         |
  Fly   343 KLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENG-------------------------P 382

  Fly   211 SFFECMVCRAIFDTFADYEKHEAKCHEDHERAQLEVNQ-MSHMHPDDYLPMKFAVPDLDT 269
            :.::|.:|..........::|..:.|.: :..|||::: :....|||     |.:|.::|
  Fly   383 NRYKCQLCGFSSHRSDKMKEHVQRVHTE-KPVQLELSETVDSSFPDD-----FELPVIET 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 48/164 (29%)
C2H2 Zn finger 18..39 CDD:275368 5/20 (25%)
C2H2 Zn finger 48..68 CDD:275368 5/19 (26%)
C2H2 Zn finger 76..96 CDD:275368 6/19 (32%)
C2H2 Zn finger 104..124 CDD:275368 7/19 (37%)
C2H2 Zn finger 132..148 CDD:275368 5/17 (29%)
C2H2 Zn finger 160..180 CDD:275368 8/19 (42%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 53/214 (25%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
C2H2 Zn finger 330..349 CDD:275368 5/18 (28%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
C2H2 Zn finger 387..408 CDD:275368 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.