DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17385 and CG18262

DIOPT Version :9

Sequence 1:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:249 Identity:66/249 - (26%)
Similarity:103/249 - (41%) Gaps:59/249 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DETVANQFSCKR-------------CDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGN 60
            |::.:.:.|.||             |::|||::||...||.:     .|...|.:|.|.|..|||
  Fly   204 DKSASERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWK-----HTGIFCDICGKPFTQSGN 263

  Fly    61 LDRHMKVHNDVRPF----------------------------VCNICSKAFAQAVNLQRHYAVHS 97
            :.||.:.|:.::|.                            :|.:|.:.......|..|...|:
  Fly   264 MMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHT 328

  Fly    98 GERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKHKLGHLNAKPYQCNY 162
            ||||..|..|.|:|....::..|.::||..:||.|..||..|.:...|:.|||.|...:.|.|..
  Fly   329 GERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKL 393

  Fly   163 CEKGFTQLSNFKRHLQSHIKEGVDVDVPASIQAAA-----ALARERLESEQKPS 211
            |.|.|.|......|::||        .||.::.|.     ::..|.:|.:..|:
  Fly   394 CGKTFAQSGGLNAHMRSH--------DPARVKGAVKPLPQSVTIEVIEGKSPPT 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 58/208 (28%)
C2H2 Zn finger 18..39 CDD:275368 10/33 (30%)
C2H2 Zn finger 48..68 CDD:275368 9/19 (47%)
C2H2 Zn finger 76..96 CDD:275368 4/19 (21%)
C2H2 Zn finger 104..124 CDD:275368 5/19 (26%)
C2H2 Zn finger 132..148 CDD:275368 5/15 (33%)
C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 8/26 (31%)
C2H2 Zn finger 251..271 CDD:275368 9/19 (47%)
COG5048 <256..415 CDD:227381 46/166 (28%)
zf-H2C2_2 263..288 CDD:290200 5/24 (21%)
C2H2 Zn finger 279..327 CDD:275368 4/47 (9%)
zf-H2C2_2 320..342 CDD:290200 10/21 (48%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-C2H2 389..411 CDD:278523 7/21 (33%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.