DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17385 and Zbtb26

DIOPT Version :9

Sequence 1:	NP_001286418.1	Gene:	CG17385 / 36603	FlyBaseID:	FBgn0033934	Length:	278	Species:	Drosophila melanogaster
Sequence 2:	NP_001101310.1	Gene:	Zbtb26 / 311910	RGDID:	1308561	Length:	451	Species:	Rattus norvegicus

Alignment Length:	116	Identity:	46/116 - (39%)
Similarity:	65/116 - (56%)	Gaps:	11/116 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 CKRCDRTFRSKRDQTLHRQEVHNHNK--TTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICS 80
            |.:|.|.||       |.:...||.|  ..:.|.||.|:|...|||.|||:||..::||.|.||.
  Rat   286 CPKCTRVFR-------HLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICG 343

  Fly    81 KAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRH-KMTHTGEKPF 130
            |.|:|..:||.|..:|||::|..||:|:..|..:..:::| |..| |:..|
  Rat   344 KTFSQKCSLQDHLNLHSGDKPHKCNYCDMVFAHKPVLRKHLKQLH-GKNSF 393

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17385	NP_001286418.1	COG5048	<13..181	CDD:227381	46/116 (40%)
		C2H2 Zn finger	18..39	CDD:275368	6/20 (30%)
		C2H2 Zn finger	48..68	CDD:275368	11/19 (58%)
		C2H2 Zn finger	76..96	CDD:275368	9/19 (47%)
		C2H2 Zn finger	104..124	CDD:275368	6/20 (30%)
		C2H2 Zn finger	132..148	CDD:275368
		C2H2 Zn finger	160..180	CDD:275368
Zbtb26	NP_001101310.1	BTB	34..134	CDD:279045
		BTB	45..138	CDD:197585
		C2H2 Zn finger	286..306	CDD:275368	9/26 (35%)
		zf-C2H2	309..331	CDD:278523	11/21 (52%)
		C2H2 Zn finger	311..331	CDD:275368	11/19 (58%)
		zf-H2C2_2	326..348	CDD:290200	12/21 (57%)
		C2H2 Zn finger	339..359	CDD:275368	9/19 (47%)
		zf-H2C2_2	351..376	CDD:290200	11/24 (46%)
		C2H2 Zn finger	367..385	CDD:275368	5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0005566
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000