DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17385 and Zbtb6

DIOPT Version :9

Sequence 1:	NP_001286418.1	Gene:	CG17385 / 36603	FlyBaseID:	FBgn0033934	Length:	278	Species:	Drosophila melanogaster
Sequence 2:	NP_666365.1	Gene:	Zbtb6 / 241322	MGIID:	2442998	Length:	423	Species:	Mus musculus

Alignment Length:	126	Identity:	44/126 - (34%)
Similarity:	64/126 - (50%)	Gaps:	13/126 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 DETVANQFSCKRCDRTFRSKRDQTLHRQEVHNHNK--TTYECKLCAKSFCNSGNLDRHMKVHNDV 71
            ||..:.:..|.||.|.|       ||.:....|.|  ..:.|..|.|:|....||:||::.|..:
Mouse   293 DENFSLRHQCPRCPRGF-------LHVENYLRHLKMHKLFLCLQCGKTFTQKKNLNRHIRGHMGI 350

  Fly    72 RPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMT----HTGEK 128
            |||.|.:|.|.|.....||.|..:|||:||:.|:.|:..|..:|.:|:|..:    .:|||
Mouse   351 RPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEK 411

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17385	NP_001286418.1	COG5048	<13..181	CDD:227381	42/122 (34%)
		C2H2 Zn finger	18..39	CDD:275368	7/20 (35%)
		C2H2 Zn finger	48..68	CDD:275368	8/19 (42%)
		C2H2 Zn finger	76..96	CDD:275368	7/19 (37%)
		C2H2 Zn finger	104..124	CDD:275368	6/23 (26%)
		C2H2 Zn finger	132..148	CDD:275368
		C2H2 Zn finger	160..180	CDD:275368
Zbtb6	NP_666365.1	BTB	23..123	CDD:279045
		BTB	34..127	CDD:197585
		C2H2 Zn finger	302..322	CDD:275368	9/26 (35%)
		zf-C2H2	325..347	CDD:278523	8/21 (38%)
		C2H2 Zn finger	327..347	CDD:275368	8/19 (42%)
		zf-H2C2_2	339..363	CDD:290200	11/23 (48%)
		C2H2 Zn finger	355..375	CDD:275368	7/19 (37%)
		C2H2 Zn finger	383..400	CDD:275368	5/16 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0005566
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000