DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17385 and Zbtb37

DIOPT Version :9

Sequence 1:	NP_001286418.1	Gene:	CG17385 / 36603	FlyBaseID:	FBgn0033934	Length:	278	Species:	Drosophila melanogaster
Sequence 2:	NP_001343418.1	Gene:	Zbtb37 / 240869	MGIID:	2444467	Length:	504	Species:	Mus musculus

Alignment Length:	101	Identity:	40/101 - (39%)
Similarity:	56/101 - (55%)	Gaps:	10/101 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 LHRQEV------HNHNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQR 91
            |..|||      :|...|   |..|||||...|:|||||::|..:.||||.:|.|.:.:...|:.
Mouse   359 LREQEVSERWFRYNPRLT---CIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEY 420

  Fly    92 HYAVHSGERPFTCNFCNKSFTQQSNMKRH-KMTHTG 126
            |...|:|.:||.|:.|.|||..|:.:.:| :..|.|
Mouse   421 HIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPG 456

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17385	NP_001286418.1	COG5048	<13..181	CDD:227381	40/101 (40%)
		C2H2 Zn finger	18..39	CDD:275368	4/11 (36%)
		C2H2 Zn finger	48..68	CDD:275368	12/19 (63%)
		C2H2 Zn finger	76..96	CDD:275368	5/19 (26%)
		C2H2 Zn finger	104..124	CDD:275368	7/20 (35%)
		C2H2 Zn finger	132..148	CDD:275368
		C2H2 Zn finger	160..180	CDD:275368
Zbtb37	NP_001343418.1	BTB_POZ_ZBTB37	9..131	CDD:349531
		C2H2 Zn finger	377..397	CDD:275368	12/19 (63%)
		zf-H2C2_2	389..414	CDD:404364	12/24 (50%)
		zf-C2H2	403..425	CDD:395048	7/21 (33%)
		C2H2 Zn finger	405..425	CDD:275368	5/19 (26%)
		zf-H2C2_2	418..440	CDD:404364	9/21 (43%)
		C2H2 Zn finger	433..451	CDD:275368	7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000