DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17385 and che-1

DIOPT Version :9

Sequence 1:	NP_001286418.1	Gene:	CG17385 / 36603	FlyBaseID:	FBgn0033934	Length:	278	Species:	Drosophila melanogaster
Sequence 2:	NP_001076598.1	Gene:	che-1 / 183847	WormBaseID:	WBGene00000483	Length:	273	Species:	Caenorhabditis elegans

Alignment Length:	109	Identity:	49/109 - (44%)
Similarity:	68/109 - (62%)	Gaps:	0/109 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    72 RPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCG 136
            :||.|..|.|||:||.||..|..:|:||:||.|..||:.|:|.|::..|:.|||||:|:.|.:|.
Worm   164 KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCE 228

  Fly   137 RYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSH 180
            :.|:....|.||...|...|||.|:.|...|||..|..||:::|
Worm   229 KAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 272

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17385	NP_001286418.1	COG5048	<13..181	CDD:227381	49/109 (45%)
		C2H2 Zn finger	18..39	CDD:275368
		C2H2 Zn finger	48..68	CDD:275368
		C2H2 Zn finger	76..96	CDD:275368	10/19 (53%)
		C2H2 Zn finger	104..124	CDD:275368	7/19 (37%)
		C2H2 Zn finger	132..148	CDD:275368	4/15 (27%)
		C2H2 Zn finger	160..180	CDD:275368	8/19 (42%)
che-1	NP_001076598.1	zf-C2H2	166..188	CDD:278523	11/21 (52%)
		C2H2 Zn finger	168..188	CDD:275368	10/19 (53%)
		zf-H2C2_2	180..205	CDD:290200	12/24 (50%)
		C2H2 Zn finger	196..216	CDD:275368	7/19 (37%)
		zf-H2C2_2	208..232	CDD:290200	9/23 (39%)
		C2H2 Zn finger	224..244	CDD:275368	6/19 (32%)
		zf-H2C2_2	237..261	CDD:290200	10/23 (43%)
		C2H2 Zn finger	252..272	CDD:275368	8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S2111
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.860